GapMind for catabolism of small carbon sources

 

Aligments for a candidate for iatA in Pseudomonas putida KT2440

Align Inositol transport ATP-binding protein IatA, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate PP_2455 PP_2455 ribose ABC transporter - ATP-binding subunit

Query= TCDB::B8H229
         (515 letters)



>lcl|FitnessBrowser__Putida:PP_2455 PP_2455 ribose ABC transporter -
           ATP-binding subunit
          Length = 524

 Score =  350 bits (898), Expect = e-101
 Identities = 204/486 (41%), Positives = 298/486 (61%), Gaps = 12/486 (2%)

Query: 19  LDQVDLVVGVGEVHALLGENGAGKSTLIKILSAAHAADAGTVTFAGQVLDPRDAPLRRQQ 78
           L +V L +  GEV AL GENGAGKSTL K++S       G +T+ GQ   P       ++
Sbjct: 31  LGEVSLSLRAGEVLALTGENGAGKSTLSKLISGLEVPTTGHMTYRGQAYAPGSRG-EAER 89

Query: 79  LGIATIYQEFNLFPELSVAENMYLGREPRRLGLVDWSRLRADAQALLNDLGLP-LNPDAP 137
           LG+  + QE NL P L+VAEN++L   P R G +   RLR  A A +  +GL  ++PD P
Sbjct: 90  LGVRMVMQELNLLPTLTVAENLFLDNLPSRFGWISHKRLRQLATAAMARVGLDAIDPDTP 149

Query: 138 VRGLTVAEQQMVEIAKAMTLNARLIIMDEPTAALSGREVDRLHAIIAGLKARSVSVIYVS 197
           V  L +  QQMVEIA+ +  +  ++I+DEPTA L+ REV  L   I  L+AR V+++Y+S
Sbjct: 150 VGELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTAREVALLFTQIERLRARGVAIVYIS 209

Query: 198 HRLGEVKAMCDRYTVMRDGRFVASGDVADVEVADMVRLMVGRHVEFERRKRRRPPGAVVL 257
           HRL E++ +  R  V+RDG+ V    +     A++V LMVGR +       RR  GA +L
Sbjct: 210 HRLEELQRVAQRIVVLRDGKLVCDEPIQRYSSAELVNLMVGRELGEHIDLGRRQLGAPLL 269

Query: 258 KVEGVTPAAPRLSAPGYLRQVSFAARGGEIVGLAGLVGAGRTDLARLIFGADPIAAGRVL 317
           KV+       +L     +R+VSF  R GEI G++GL+GAGRT+L RLI+GAD   +G + 
Sbjct: 270 KVD-------KLCRGDKVREVSFEVRAGEIFGISGLIGAGRTELLRLIYGADRADSGGIA 322

Query: 318 VDDKP--LRLRSPRDAIQAGIMLVPEDRKQQGCFLDHSIRRNLSLPSLKALSALGQWVDE 375
           +   P  + + SP+ A++AGI L+ EDRK +G  L  SI  N++L +L A+S  G  +D 
Sbjct: 323 LGQPPQAVSIDSPKAAVRAGIALITEDRKGEGLLLTQSISANIALGNLGAVSRAGV-LDS 381

Query: 376 RAERDLVETYRQKLRIKMADAETAIGKLSGGNQQKVLLGRAMALTPKVLIVDEPTRGIDI 435
            AE+ L E   Q +RI+ A A+  +G+LSGGNQQKV++GR +    +VL+ DEPTRGID+
Sbjct: 382 EAEKALAERQIQAMRIRSAGAQQVVGELSGGNQQKVVIGRWLERDCQVLLFDEPTRGIDV 441

Query: 436 GAKAEVHQVLSDLADLGVAVVVISSELAEVMAVSDRIVVFREGVIVADLDAQTATEEGLM 495
           GAK +++ +L++LA  G A+VV+SS+L E+M + DRI V   G ++        +++ L+
Sbjct: 442 GAKFDIYGLLAELARQGKALVVVSSDLRELMLICDRIAVLSAGRLIDTFARDHWSQDQLL 501

Query: 496 AYMATG 501
           A    G
Sbjct: 502 AAAFAG 507


Lambda     K      H
   0.320    0.136    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 680
Number of extensions: 36
Number of successful extensions: 10
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 515
Length of database: 524
Length adjustment: 35
Effective length of query: 480
Effective length of database: 489
Effective search space:   234720
Effective search space used:   234720
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory