Align methylmalonate-semialdehyde dehydrogenase (CoA-acylating) (EC 1.2.1.27) (characterized)
to candidate PP_5063 PP_5063 betaine aldehyde dehydrogenase, NAD-dependent
Query= BRENDA::P42412 (487 letters) >FitnessBrowser__Putida:PP_5063 Length = 490 Score = 265 bits (677), Expect = 3e-75 Identities = 167/483 (34%), Positives = 258/483 (53%), Gaps = 10/483 (2%) Query: 1 MAEIRKLKNYINGEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTW 60 MA K YI+G +V++ +D + +NPAT EVL V +T+ D++ A ++A K W Sbjct: 1 MARFGTQKLYIDGAYVDAGSDATFEAINPATGEVLAHVQRATEADVEKAVESAERGQKVW 60 Query: 61 SKVAVPRRARILFNFQQLLSQHKEELAHLITIENGKNTKEA-LGEVGRGIENVEFAAGAP 119 + + +R+RIL +L + +ELA L T++ GK+ E ++ G + +E+ AG Sbjct: 61 AAMTAMQRSRILRRAVDILRERNDELAMLETLDTGKSYSETRYVDIVTGADVLEYYAGLV 120 Query: 120 SLMMGDSLASIATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSE 179 + G+ + + R P+GV GI +N+P+ + W A+A GN I KPSE Sbjct: 121 PAIEGEQIP-LRESSFVYTRREPLGVTVGIGAWNYPIQIALWKSAPALAAGNAMIFKPSE 179 Query: 180 RTPLLTEKLVELFEKAGLPKGVFNVVYGA-HDVVNGILEHPEIKAISFVGSKPVGEYVY- 237 T L T KL E++ +AGLP GVFNV+ G+ +V + EHP I+ +SF G G+ V Sbjct: 180 VTSLTTLKLAEIYTEAGLPNGVFNVLTGSGREVGTWLTEHPRIEKVSFTGGTTTGKKVMA 239 Query: 238 KKGSENLKRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIA 297 S +LK V G K+ I+ DA+L+ + A F S+G+ C V + + Sbjct: 240 SASSSSLKEVTMELGGKSPLIICADADLDKAADIAMMANFYSSGQVCTNGTRVFIPAEMK 299 Query: 298 DEFMAKLQEKVADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGRENV 357 F AK+ E+VA I++GN D+ GP++ + + L YI KG EEGAR++C G Sbjct: 300 AAFEAKIAERVARIRVGNPEDENTNFGPLVSFQHMESVLGYIAKGKEEGARVLCGGERLT 359 Query: 358 SDD---GYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACL 414 + D G FV PT+F + T +MTI K+EIF PV+S++ + +E I AN +++ A + Sbjct: 360 AGDFAKGAFVAPTVFTDCTDDMTIVKEEIFGPVMSILTYETEEEVIRRANDTDYGLAAGV 419 Query: 415 FTSNSNAIRYFRENIDAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKDSVDFYTRK 474 T++ ++AG+ IN +P A P G+K S G NG S+ YTR Sbjct: 420 CTNDITRAHRIIHKLEAGICWINAWGESP-AEMPVGGYKQS--GVGRENGVSSLAQYTRI 476 Query: 475 KVV 477 K V Sbjct: 477 KSV 479 Lambda K H 0.318 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 547 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 490 Length adjustment: 34 Effective length of query: 453 Effective length of database: 456 Effective search space: 206568 Effective search space used: 206568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory