GapMind for catabolism of small carbon sources

 

Aligments for a candidate for H281DRAFT_04042 in Pseudomonas putida KT2440

Align Aromatic amino acid transporter AroP (characterized, see rationale)
to candidate PP_0927 PP_0927 aromatic amino acid transport protein

Query= uniprot:A0A2Z5MFR8
         (461 letters)



>lcl|FitnessBrowser__Putida:PP_0927 PP_0927 aromatic amino acid
           transport protein
          Length = 453

 Score =  624 bits (1610), Expect = 0.0
 Identities = 298/451 (66%), Positives = 364/451 (80%)

Query: 1   MDNALQQDGLKRGLKNRHIQLIALGGAIGTGLFLGSASVLQAAGPSMILGYAIGGVIAFM 60
           M +    + L+RGLKNRHIQLIALGGAIGTGLFLG A  +Q AGPS++LGYAI G++AF+
Sbjct: 1   MQDQSTPERLQRGLKNRHIQLIALGGAIGTGLFLGIAQTIQLAGPSVLLGYAIAGLMAFL 60

Query: 61  IMRQLGEMVAQEPVAGSFSHFAYKYWGDFPGFLSGWNYWVLYVLVSMAELTAVGTYVHYW 120
           IMRQLGEMV +EPVAGSFSHFA++YW +F GF+SGWNYWV+YVLV MAELTAVG YV YW
Sbjct: 61  IMRQLGEMVVEEPVAGSFSHFAHQYWSEFAGFVSGWNYWVVYVLVGMAELTAVGIYVQYW 120

Query: 121 WPGVPTWVSALVCFAGINAINLANVKAYGETEFWFAIIKVVAVIGMILFGGYLLVSGHGG 180
           WP  PTW +A + F  IN INL  VK YGE EFWFA++KVVA++ MI FG +LL SGHGG
Sbjct: 121 WPDFPTWATAAIFFVVINLINLTQVKVYGEMEFWFALVKVVAIVSMIGFGAWLLGSGHGG 180

Query: 181 PQASISNLWSHGGFFPHGFHGLFTMLAVIMFSFGGLELIGITAAEADEPQKSIPKAVNQV 240
           P AS++NLW +GGFFP+G  GL   LAVIMFSFGGLEL+GITAAEAD P++SIPKA NQV
Sbjct: 181 PDASVANLWQYGGFFPNGVTGLVMALAVIMFSFGGLELVGITAAEADNPRESIPKATNQV 240

Query: 241 IYRILIFYICSLAVLLSLYPWNEVAAGGSPFVMIFSQIGSTLTANVLNVVVLTAALSVYN 300
           +YRILIFYI +LAVLLSLYPW +V  GGSPFVMIF ++ S L A +LN+VVLTAALSVYN
Sbjct: 241 VYRILIFYIGALAVLLSLYPWQKVVQGGSPFVMIFHELDSDLVATILNIVVLTAALSVYN 300

Query: 301 SGVYANSRMLYGLAEQGNAPRALMKVDRRGVPYMAIGLSALATFTCVIVNYLIPAEALGL 360
           S VYANSRML+GLA QG+APR L+KV R GVP  A+ +SA AT  CV++NYL+P  A GL
Sbjct: 301 SCVYANSRMLFGLASQGDAPRQLLKVSRSGVPLTALAVSAFATGLCVLINYLMPGGAFGL 360

Query: 361 LMALVVAALVLNWALISLTHLKSRRAMVAAGETLVFKSFWFPVSNWICLAFMALILVILA 420
           LMAL V+ALV+NWA IS+THLK R+A +AAG T  +KS   P++N++CLAF+ LILV++ 
Sbjct: 361 LMALAVSALVINWASISITHLKFRKAKLAAGITPFYKSLGHPLTNYLCLAFIVLILVVMY 420

Query: 421 MTPGLSVSVLLVPLWLVVMWAGYAFKRRRAA 451
           +TP + +SV+L+P W+ V+W  +  K+ R A
Sbjct: 421 LTPPIRISVMLIPAWIAVLWVAFKLKKARQA 451


Lambda     K      H
   0.327    0.140    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 594
Number of extensions: 26
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 461
Length of database: 453
Length adjustment: 33
Effective length of query: 428
Effective length of database: 420
Effective search space:   179760
Effective search space used:   179760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory