Align BadH (characterized)
to candidate PP_1852 PP_1852 putative enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific)
Query= metacyc::MONOMER-893 (255 letters) >FitnessBrowser__Putida:PP_1852 Length = 249 Score = 148 bits (373), Expect = 1e-40 Identities = 93/249 (37%), Positives = 141/249 (56%), Gaps = 11/249 (4%) Query: 4 LQNKTAVITGGGGGIGGATCRRFAQEGAKIA-VFDLNLDAAEKVAGAIRDAGGTAEAVRC 62 L+ K A++ GG GIG A RR A+EGA++A + + AE++A I + GG A A+R Sbjct: 7 LEGKVALVQGGSRGIGAAIVRRLAREGAQVAFTYVSSAGPAEELAREITENGGKALALRA 66 Query: 63 DIADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMH 122 D AD +V A+ T LG +DILVNNAG P T+ + +++ ++A+N+ Sbjct: 67 DSADAAAVQLAVDDTEKALGRLDILVNNAGVLAVAPVTEFDLADFDHMLAVNVRSVFVAS 126 Query: 123 HAVLPGMVERRHGRIVNIAS-DAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVN 181 A M + GRI+NI S +A R+ +G A YA K LV ++ +AR+ GITVN Sbjct: 127 QAAARYM--GQGGRIINIGSTNAERMPFAGGAPYAMSKSALVGLTRGMARDLGPQGITVN 184 Query: 182 VVCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFIT 241 V PGP DT + + SG + E+ + +GR G+P+++A +A+ +AG+IT Sbjct: 185 NVQPGPVDTDM--NPASG-----EFAESLIPLMAIGRYGEPEEIASFVAYLAGPEAGYIT 237 Query: 242 GQVLSVSGG 250 G L+V GG Sbjct: 238 GASLTVDGG 246 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 249 Length adjustment: 24 Effective length of query: 231 Effective length of database: 225 Effective search space: 51975 Effective search space used: 51975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory