Align 1,2-phenylacetyl-CoA epoxidase, subunit E; 1,2-phenylacetyl-CoA epoxidase, reductase subunit; 1,2-phenylacetyl-CoA monooxygenase, subunit E; EC 1.-.-.- (characterized)
to candidate PP_1163 PP_1163 Oxidoreductase, FAD-binding
Query= SwissProt::P76081 (356 letters) >FitnessBrowser__Putida:PP_1163 Length = 678 Score = 119 bits (297), Expect = 3e-31 Identities = 109/347 (31%), Positives = 163/347 (46%), Gaps = 30/347 (8%) Query: 9 VAKVESETRDAVTITFAVPQPLQEAYRFRPGQHLTLKASFDGEE-LRRCYSICRSYLPGE 67 V +VE E+RD + P + A F PGQHL ++ DGE L R YS+ + G Sbjct: 334 VLRVEQESRDIRSFYLEPPAGCRVA--FAPGQHLPVQVPRDGESALIRTYSLSSAPDDGF 391 Query: 68 ISVAVKAIEGGRFSRYAREHIRQGMTLEVMVPQGHFGYQPQAERQGRYLAIAAGSGITPM 127 + ++VKA G SRY E + G L V P G F Q+ R + I AG GITP+ Sbjct: 392 LRISVKA--QGPASRYLHERVVAGDVLNVRPPMGSFTLDQQSTRP--LVLIGAGVGITPL 447 Query: 128 LAIIATTLQTEPESQFTLIYGNRTSQSMMFRQALADLKDKYPQRLQLLCIFSQETLDSDL 187 LA++ L+T + L +G R+ + F+Q LA L+ + LQ+ SQ + + Sbjct: 448 LAMLRQQLRTGQARRIHLFHGARSLADLPFQQELAALRQQAGDLLQVHRALSQPEGHAQV 507 Query: 188 LHGRIDGEKLQSLGASLINFRL----YDEAFICGPAAMMDDAETALKALGMPDKTIHLER 243 GR D E LG + L YD ++CGP + L+ + +PD IH E Sbjct: 508 --GR-DYEFAGRLGIEQVKATLALDDYD-FYLCGPGSFTQQLYEGLRGVHVPDARIHAEA 563 Query: 244 FNTPGTRVKRSVNVQ--------SDGQKVTVRQDGRDREIVLNADDESILDAALRQGADL 295 F P T ++R + + + V V +E ++L+ A +G Sbjct: 564 FG-PST-LRRHTDADQPVLQQPPAADEPVPVYFAASAKEARWVPGSGTLLELAEARGLAP 621 Query: 296 PYACKGGVCATCKCKVLRGKVAMETNYSLEPDEL-AAGYVLSCQALP 341 ++C+GG C TCK +++ G+V +Y P EL AG VL C A+P Sbjct: 622 EFSCRGGSCGTCKTRLVSGQV----HYPNPPAELPEAGSVLICCAVP 664 Lambda K H 0.320 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 535 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 678 Length adjustment: 34 Effective length of query: 322 Effective length of database: 644 Effective search space: 207368 Effective search space used: 207368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory