GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaJ1 in Pseudomonas putida KT2440

Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate PP_3280 PP_3280 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase

Query= metacyc::MONOMER-15952
         (401 letters)



>lcl|FitnessBrowser__Putida:PP_3280 PP_3280
           3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase
          Length = 406

 Score =  703 bits (1815), Expect = 0.0
 Identities = 353/399 (88%), Positives = 377/399 (94%)

Query: 3   EALIIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQAGE 62
           +ALIIDAVRTPIGRYAGAL+SVRADDL AIPLKALI RHP+LDW A+DDVI+GCANQAGE
Sbjct: 8   DALIIDAVRTPIGRYAGALSSVRADDLAAIPLKALIQRHPELDWKAIDDVIFGCANQAGE 67

Query: 63  DNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESMSR 122
           DNRNVA MA+LLAGLP+ VPGTT+NRLCGSGLDA+G+AARALRCGEAGLMLAGGVESMSR
Sbjct: 68  DNRNVAHMASLLAGLPLEVPGTTINRLCGSGLDAIGNAARALRCGEAGLMLAGGVESMSR 127

Query: 123 APFVMGKSEQAFGRSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNISRADQD 182
           APFVMGKSEQAFGR+AE+FDTTIGWRFVN LM+  +GIDSMPETAENVA QF ISRADQD
Sbjct: 128 APFVMGKSEQAFGRAAELFDTTIGWRFVNPLMKAAYGIDSMPETAENVAEQFGISRADQD 187

Query: 183 AFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQLAKLGTPF 242
           AFALRSQHKAAAA A GRLA+EIV VEI QRKGPAK+VEHDEHPRGDTTLEQLA+LGTPF
Sbjct: 188 AFALRSQHKAAAAQARGRLAREIVPVEIPQRKGPAKVVEHDEHPRGDTTLEQLARLGTPF 247

Query: 243 RQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRIMGIGPVPA 302
           R+GGSVTAGNASGVNDGACALLLASS AA+RHGLKAR R+VGMA AGVEPR+MGIGPVPA
Sbjct: 248 REGGSVTAGNASGVNDGACALLLASSAAARRHGLKARGRIVGMAVAGVEPRLMGIGPVPA 307

Query: 303 TRKVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVNPNGGAIALGHPLGMS 362
           TRKVL LTGLALAD+DVIELNEAFAAQGLAVLRELGLADDD RVN NGGAIALGHPLGMS
Sbjct: 308 TRKVLALTGLALADLDVIELNEAFAAQGLAVLRELGLADDDPRVNRNGGAIALGHPLGMS 367

Query: 363 GARLVTTALHELEERQGRYALCTMCIGVGQGIALIIERI 401
           GARLVTTALHELEE  GRYALCTMCIGVGQGIA+IIER+
Sbjct: 368 GARLVTTALHELEETAGRYALCTMCIGVGQGIAMIIERL 406


Lambda     K      H
   0.319    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 665
Number of extensions: 18
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 406
Length adjustment: 31
Effective length of query: 370
Effective length of database: 375
Effective search space:   138750
Effective search space used:   138750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory