GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ppa in Pseudomonas putida KT2440

Align Phenylacetate permease, Ppa (characterized)
to candidate PP_2797 PP_2797 acetate permease

Query= TCDB::O50471
         (520 letters)



>lcl|FitnessBrowser__Putida:PP_2797 PP_2797 acetate permease
          Length = 552

 Score =  620 bits (1600), Expect = 0.0
 Identities = 305/523 (58%), Positives = 400/523 (76%), Gaps = 3/523 (0%)

Query: 1   MNWTAISMFMVFVCFTLLVTRWAALRTRSASDFYTAGGGLTGMQNGLAIAGDMISAASFL 60
           +N  AI MFMVFV FTL +T WAA RTRS +DFY+AGGG+ G QNGLA+AGD +SA++ L
Sbjct: 30  LNLHAIGMFMVFVLFTLCITWWAARRTRSTTDFYSAGGGIQGWQNGLALAGDYMSASTLL 89

Query: 61  GISAMMFMNGYDGLLYALGVLAGWPIILFLIAERLRNLGKYTFADVVSYRLAQTPVRLTS 120
           GI+A+++ +G DG +Y +   AGWP++L L+ ERLRNLG++TFAD+ SYRL Q  VR  +
Sbjct: 90  GITALIYTSGMDGYIYLIAFFAGWPVLLLLMTERLRNLGRFTFADITSYRLDQGKVRTMA 149

Query: 121 AFGTLVVALMYLVAQMVGAGKLIELLFGISYLYAVMLVGVLMVAYVTFGGMLATTWVQII 180
           A G+L V   YLVAQMVGAG+LI LLFG+ Y  AV++VG LM+ YVTFGGM+ATTWVQII
Sbjct: 150 AIGSLTVVCFYLVAQMVGAGQLIRLLFGLDYHIAVVIVGALMMLYVTFGGMVATTWVQII 209

Query: 181 KAVMLLSGTSFMAFMVLKHFGFSTEAMFASAVAVHAKGQAIMAPGGLLSNPVDAISLGLG 240
           KA +LL G S + F+ ++ F FS +A+ + A+  HA G+ ++APG LL++P+ A+SL LG
Sbjct: 210 KAFLLLVGGSLVLFLAMREFDFSYDALVSKAMDTHALGERLLAPGSLLADPLTALSLSLG 269

Query: 241 MMFGTAGLPHILMRFFTVSDAKEARKSVFYATGFIGYFYLLLIVIGFGAIVMVGTEPSY- 299
           ++FGTAGLPHILMRFFTVSDA+EARKSV YATGFIGYF+ ++ ++G  +IV+V  +P + 
Sbjct: 270 LVFGTAGLPHILMRFFTVSDAREARKSVLYATGFIGYFFNVIFLLGLASIVIVSQQPKFF 329

Query: 300 --RDATGAIIGGGNMIAVHLAQAVGGNLFLGFISAVAFATILAVVAGLALSGASAVSHDL 357
              +  G ++GGGNM+ +HLAQAVGGNL LGF+SAV FATILAVV+GLAL+GASA++HDL
Sbjct: 330 EGGEVGGKLLGGGNMVVMHLAQAVGGNLLLGFLSAVTFATILAVVSGLALAGASAIAHDL 389

Query: 358 YACVIRQGKATEQEEMRVSRIATLLIGLLAVLLGLMFESQNIAFLSGLVLAVAASVNFPV 417
           YA VI +G A+E +E+RV+++ATL +GL+A+ LG++FE+ N+AF+  L   +AAS NFPV
Sbjct: 390 YARVIMKGAASEAQELRVTKLATLSLGLVAIALGILFENINVAFMVALAFGIAASANFPV 449

Query: 418 LLLSMFWKGLTTRGAVCGSMAGLASAVLLVVLGPAVWVNVLHHEKALFPYSNPALFSMSL 477
           L LSMFW GLTTRGA+     GL SA+  VV    VWV+VLH  + LFPY+ PALFSM L
Sbjct: 450 LFLSMFWSGLTTRGALAAGYVGLLSAMGFVVFSKLVWVDVLHFAEPLFPYTQPALFSMPL 509

Query: 478 AFLSAWVFSVTDSSERASEERGRYLAQFIRSMTGIGAAGASKH 520
           AFL A+  S  D + RA  ER  +  QF+R  TG+GA+GA  H
Sbjct: 510 AFLVAYAVSRMDRTARAKAERAAFADQFVRGQTGLGASGAVDH 552


Lambda     K      H
   0.328    0.139    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 872
Number of extensions: 43
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 520
Length of database: 552
Length adjustment: 35
Effective length of query: 485
Effective length of database: 517
Effective search space:   250745
Effective search space used:   250745
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory