Align aspartate transaminase; EC 2.6.1.1 (characterized)
to candidate PP_3721 PP_3721 Arginine--pyruvate transaminase AruH
Query= CharProtDB::CH_088628 (385 letters) >FitnessBrowser__Putida:PP_3721 Length = 396 Score = 255 bits (651), Expect = 2e-72 Identities = 151/371 (40%), Positives = 214/371 (57%), Gaps = 9/371 (2%) Query: 19 VNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALA 78 ++ +AL L+ + D++ L+ G+PDFDTP + EAA +L G T YA G LR+A+A Sbjct: 20 IHYRALALQAEDKDILLLSVGDPDFDTPAPIVEAAIDSLRAGHTHYADVRGKLALRQAIA 79 Query: 79 EKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGV 138 + R+ +G +V+ ++ V G + AL+ + Q ILDPGDEVIV P +V+Y + G Sbjct: 80 NRHRQRSGQAVSADQVTVLAGAQCALYCVAQCILDPGDEVIVAEPMYVTYEAVFGACGAK 139 Query: 139 VVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDF 198 VV V PE GF P V ITPRT+AL +NSP+NP+GA P+ EALA L V HD Sbjct: 140 VVPVPVKPENGFRVCPRDVAERITPRTRALALNSPHNPSGASLPRATWEALAELCVAHDL 199 Query: 199 YLVSDEIYEHLLYEGEHFSPGRV--APEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAM 256 +L+SDE+Y LLYEGEH SPG + E T T+N +K+ AMTGWR+G+ G + + Sbjct: 200 WLISDEVYSELLYEGEHVSPGSLPGMAERTATLNSLSKSHAMTGWRMGWVVGSTALATHL 259 Query: 257 ASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTAL-GLKAV 315 +++ Q A + AL E ++ REAYR+RRDL+ E L GLKA+ Sbjct: 260 ENLALCMLYGLPDFVQDAAVVAL---EHPLPELDAMREAYRQRRDLVCEQLAGCPGLKAL 316 Query: 316 RPSGAFYVLMDTSPIAPDEVRAAERLLEA-GVAVVPGTDF--AAFGHVRLSYATSEENLR 372 +P G +V++D A+ LL++ GV+V+ G F +A GH+RL E L Sbjct: 317 KPDGGMFVMLDIRETGVSAQAFADYLLDSQGVSVLAGEAFGPSAAGHIRLGLVLGNEALV 376 Query: 373 KALERFARVLG 383 A +R AR G Sbjct: 377 DACQRIARCAG 387 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 396 Length adjustment: 31 Effective length of query: 354 Effective length of database: 365 Effective search space: 129210 Effective search space used: 129210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory