GapMind for catabolism of small carbon sources

 

Aligments for a candidate for AZOBR_RS08260 in Pseudomonas putida KT2440

Align Branched-chain amino acid ABC transporter,substrate-binding periplasmic component (characterized, see rationale)
to candidate PP_1141 PP_1141 branched-chain amino acids ABC transporter - periplasmic leucine binding subunit

Query= uniprot:G8ALJ3
         (366 letters)



>lcl|FitnessBrowser__Putida:PP_1141 PP_1141 branched-chain amino
           acids ABC transporter - periplasmic leucine binding
           subunit
          Length = 371

 Score =  282 bits (722), Expect = 9e-81
 Identities = 147/361 (40%), Positives = 217/361 (60%), Gaps = 3/361 (0%)

Query: 4   KLSLLVAVAATAMTAS--VAKADIAVATAGPITGQYATFGEQMKKGIEQAVADINAAGGV 61
           K+S L A    A  AS   A   I +  AGP TG    +G+    G +QA+ DINAAGGV
Sbjct: 3   KISKLFAAMVLAGVASHSFAADTIKIGIAGPKTGPVTQYGDMQFIGAKQAIKDINAAGGV 62

Query: 62  LGQKLKLEVGDDACDPKQAVAVANQLAKAGVKFVAGHFCSGSSIPASQVYAEEGVLQISP 121
            G+ L+ +  DDACDPKQAVAVAN++   GVKFV GH CS S+ PAS +Y +EGV+ I+P
Sbjct: 63  DGKMLEAKEYDDACDPKQAVAVANKVVNDGVKFVVGHLCSSSTQPASDIYEDEGVIMITP 122

Query: 122 ASTNPKLTEQNLKNVFRVCGRDDQQGQIAGKYLLENYKGKNVAILHDKSAYGKGLADETQ 181
           A+T+P++T +  K +FR  G D  QG  AG Y+ ++ K K VA+LHDK  YG+G+A   +
Sbjct: 123 AATSPEITARGYKLIFRTIGLDSAQGPAAGNYIADHVKPKVVAVLHDKQQYGEGIATAVK 182

Query: 182 KALNAGGQKEKIYEAYTAGEKDYSALVSKLKQEAVDVVYVGGYHTEAGLLARQMKDQGLN 241
           + L + G K  ++E   AG+KD+S+++ KLKQ  VD VY GGYH E GL+ RQ +++GL 
Sbjct: 183 QTLESKGTKVAVFEGLNAGDKDFSSIIQKLKQNNVDFVYYGGYHPELGLILRQAQEKGLK 242

Query: 242 APIVSGDALVTNEYWAITGPAGENTMMTFGPDPREMPEAKEAVEKFRKAGYEPEG-YTLY 300
           A  +  + +  +    I   A E  ++T        P  K+ V+  +  G +P G +   
Sbjct: 243 AKFMGPEGVGNDSISQIAQNASEGLLVTLPKSFDADPANKKIVDAIKADGKDPSGPFVFP 302

Query: 301 TYAALQIWAEAAKQANSTDSAKIADVLRKNSYNTVIGKIGFDAKGDVTSPAYVWYRWNNG 360
            Y+A+++ A+  K+A S D+ K+A+ + K ++ T  G + FD KGD+    +V Y W+ G
Sbjct: 303 AYSAVELIAQGIKKAGSDDTDKVAEAIHKGTFKTPTGDLSFDDKGDLKDFKFVVYEWHFG 362

Query: 361 Q 361
           +
Sbjct: 363 K 363


Lambda     K      H
   0.312    0.129    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 415
Number of extensions: 20
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 366
Length of database: 371
Length adjustment: 30
Effective length of query: 336
Effective length of database: 341
Effective search space:   114576
Effective search space used:   114576
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory