Align Glycine betaine/proline/choline transporter VP1723 (characterized)
to candidate PP_5374 PP_5374 Choline/carnitine/betaine transporter family protein
Query= SwissProt::Q87NZ5 (553 letters) >FitnessBrowser__Putida:PP_5374 Length = 567 Score = 382 bits (981), Expect = e-110 Identities = 194/518 (37%), Positives = 307/518 (59%), Gaps = 44/518 (8%) Query: 51 MAIVLFVVATLTFRQQVEPFFAGLRAWLVSNLDWFFLASGNVFVIVCLVLIVTPLGRVRI 110 +A+V FV+ F + F +++ N WF+L S + + + L+ + G +++ Sbjct: 21 LAVVAFVLFCALFAEHAAAVFQRASDFILQNFKWFYLISVTGVLGLLIYLMCSKFGSMKL 80 Query: 111 GGTEATPDYSYAGWLAMLFAAGMGIGLVFFGVSEPMSHFSSALGGVNIENGVRTDWAPLG 170 G + P++S+ W+AMLF+ GMGIGL+F+ V+EPM H++ P Sbjct: 81 GRDDDKPEFSFGSWIAMLFSGGMGIGLIFWSVAEPMWHYAGN---------------PF- 124 Query: 171 GAVGDTDAASALGMAATIYHWALHPWSIYALLALGLAIFSFNKGLPLTMRSIFYPLFGER 230 A G TD A+ M T++HW LHPW+I+ ++ LGLA F++ KGLPL+MRSI YPL GER Sbjct: 125 -ATGLTDEAATTAMRITLFHWGLHPWAIFTIVGLGLAYFAYRKGLPLSMRSILYPLIGER 183 Query: 231 VWGWVGHIIDILAVVATVFGLATSLGYGASQAATGLNFLFGVPMTDTTQVVLIVVITALA 290 ++G +GH++DILAVV T FG++ SLG G Q TGL+ +F +P++ Q+ LIV+IT + Sbjct: 184 IYGPIGHVVDILAVVITAFGVSQSLGLGVVQMNTGLSQVFDLPISLGVQITLIVLITLVT 243 Query: 291 LISVVAGLDSGVKRLSEINMILAAMLLFFVIIVGPTMAILTGFFDNIASYITNIPALSMP 350 +SV+AG+ G+KRLSE NM+L+ +L+ ++++GPT I+ ++ Y +++ LS Sbjct: 244 TVSVMAGVSRGMKRLSEWNMLLSVVLVVLILLLGPTRYIINLMLESTGDYASHVVGLSFW 303 Query: 351 FE-REDVNYSQGWTAFYWAWWISWSPFVGMFIARVSRGRSVREFIICVILIPSTVCVLWM 409 + ++D + WTAFYW WW++W PFVG+FIAR+S+GRS+RE I +L+P+ V ++WM Sbjct: 304 SDTQKDSGWQNWWTAFYWPWWMTWGPFVGLFIARISKGRSIRELIAGALLVPTLVTIIWM 363 Query: 410 TAFGGTAISQYVNDGY---EAVFNAELP-----------------------LKLFAMLDV 443 + FGGTA+ D E V + EL L +D Sbjct: 364 SVFGGTALKAEQLDRQQHAELVASGELQGDKAKYEGGTVLLATKQETTAAMFTLLHKIDA 423 Query: 444 MPFAEITSVVGIILVVVFFITSSDSGSLVIDTIAAGGKVDAPTPQRVFWCTFEGLVAIAL 503 ++ SV+ IL+ +FITS+DSG+ V+ T+ + G + P R+ WC EG +A+AL Sbjct: 424 GTLGKVLSVLVCILLATYFITSADSGTQVLCTLNSMGSANPPQSIRLLWCILEGAIAMAL 483 Query: 504 MLGGGLAAAQAMAVTTGLPFTIVLLVATVSLIKGLMDE 541 ++ GGL A Q ++ GLP +L+ + +L++ L E Sbjct: 484 LMAGGLKAIQMASIAAGLPIAGFILLISYTLMRSLRQE 521 Lambda K H 0.327 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 859 Number of extensions: 57 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 553 Length of database: 567 Length adjustment: 36 Effective length of query: 517 Effective length of database: 531 Effective search space: 274527 Effective search space used: 274527 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory