Align Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized)
to candidate PP_2774 PP_2774 glycine betaine ABC transporter, ATPase/permease fusion protein
Query= SwissProt::P17328 (400 letters) >FitnessBrowser__Putida:PP_2774 Length = 698 Score = 229 bits (584), Expect = 2e-64 Identities = 113/222 (50%), Positives = 159/222 (71%) Query: 44 VKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREV 103 V+ +LA+ GE+ +MG SGSGKST++R +NRLIEP+ G+VLIDG ++ ++ LR++ Sbjct: 55 VEQVNLAVRRGEVLCLMGTSGSGKSTLLRHVNRLIEPSSGEVLIDGEVLSSLTQPTLRQL 114 Query: 104 RRKKIAMVFQSFALMPHMTVLDNTAFGMELAGIAAQERREKALDALRQVGLENYAHAYPD 163 R ++I MVFQ F L+PH +VLDN A +EL G RR AL L+ VGL+ ++ +P Sbjct: 115 RSQRIGMVFQHFGLLPHRSVLDNVALPLELRGEPESTRRTAALRQLQAVGLKAWSERFPH 174 Query: 164 ELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISH 223 ELSGGM+QRVGLARAL NPDILLMDE FSALDP IR ++Q ++L + T + ++H Sbjct: 175 ELSGGMQQRVGLARALVTNPDILLMDEPFSALDPTIRRDLQGRFLQLVRERGITTLLVTH 234 Query: 224 DLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFF 265 D EA+R+ DRIA+++ G ++QVGTP E+L +PA++ V FF Sbjct: 235 DPGEALRLADRIAVLRGGRLIQVGTPGELLEHPADEGVAVFF 276 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 594 Number of extensions: 25 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 698 Length adjustment: 35 Effective length of query: 365 Effective length of database: 663 Effective search space: 241995 Effective search space used: 241995 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory