GapMind for catabolism of small carbon sources

 

Aligments for a candidate for putA in Pseudomonas putida KT2440

Align delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; EC 1.5.1.12 (characterized)
to candidate PP_0708 PP_0708 putative Betaine-aldehyde dehydrogenase

Query= CharProtDB::CH_122352
         (572 letters)



>lcl|FitnessBrowser__Putida:PP_0708 PP_0708 putative
           Betaine-aldehyde dehydrogenase
          Length = 476

 Score =  160 bits (406), Expect = 8e-44
 Identities = 146/487 (29%), Positives = 221/487 (45%), Gaps = 35/487 (7%)

Query: 76  EVKSSSSLTQSNPASHGPVATYSNATAKDVQAAIESALEARKSWASTPFADRASVFLKAA 135
           E + S  ++ ++PA   P A    A+   V  A+ +A  A  +W ST  ++RA+     A
Sbjct: 13  EGQGSDCISVNDPALGQPFAELMAASVSQVDQAVAAARSALPAWKSTCASERAAFLRGFA 72

Query: 136 DLISTKYRYDVMALTMHGQGKNAWQAEIDSAAELCDFFRFGVKYAEDLYAQQPVHH---- 191
           + +  + R  ++ + M   GK   +AEID    +  F      Y  +L  Q P  +    
Sbjct: 73  EQLGQR-REALVTVQMRNNGKPRHEAEIDLDDAIATF-----GYYAELAEQLPSKNRTVP 126

Query: 192 --APGVWNRVEYRPLEGFVYAISPFNFTAIGGNLAGAPALM-GNVVVWKPSPSAIASNWL 248
             APG   R    P+ G V  I P+NF  +      APAL  G  VV KPS         
Sbjct: 127 LAAPGFTARTRLEPV-GVVGLIVPWNFPLVTSAWKLAPALAAGCTVVLKPSEVTPLIEQA 185

Query: 249 VHQILLEAGLPKNVIQFVPGEAEEVTKTVLDHPDFAALHFTGSTNVFRNLYGQISTRVAA 308
             QI    GLP  V+  V G+AE     + +H     L FTGS +V     G    R A+
Sbjct: 186 YGQIADALGLPAGVLNIVNGKAE-TGAALSNHNGLDKLSFTGSNSV-----GSQVMRSAS 239

Query: 309 GKYRSYPRIVGETGGKNFHLIHKSADIRNAAVQTVRGAFEYQGQKCSATSRVYVASSIAD 368
            + R    +  E GGK+  ++    D+  A    V G     GQ CSATSR+ V   IAD
Sbjct: 240 AQCRP---VTLELGGKSAIVVFDDCDVDQAVEWIVAGISWNAGQMCSATSRLLVQDGIAD 296

Query: 369 SFLEQVASEAKSLKVGPPSDFTNFCGPVIHEASFTKLAKVIDEAKNDPELELLAGGSYDS 428
           + L ++ +  ++L+VG P       GP+  +A + K+A     A+ +  L+ LAGG    
Sbjct: 297 ALLPRLQAALENLRVGNPLTEEVDMGPLTSQAQWLKVASYFATAREE-GLQCLAGGHALD 355

Query: 429 SKGWYIQPTVYRTTNPDHPLLTRELFGPILVVYAYPDATEADFARIAQKIDATGEYGLTG 488
            +GW++ PT+Y     D  L T E+FGP+L    +    +A    IA+  D+   +GL  
Sbjct: 356 REGWFVSPTLYTDVPKDSRLWTEEIFGPVLCARRFATEEQA----IAEANDS--RFGLVA 409

Query: 489 SVFAQDREALAVANDVLRNAAGNFYINCKSTGAVVGQQPFGGARASGTNDKAGSGNLLSR 548
           +V + D E      D L    G+ +IN  S  AV  +  +GG + SG   + G    LS 
Sbjct: 410 TVCSADLERAERVADALE--VGHVWIN--SVQAVFVETSWGGTKGSGIGRELGPWG-LSA 464

Query: 549 FVSLRSI 555
           + S++ +
Sbjct: 465 YQSIKHV 471


Lambda     K      H
   0.316    0.130    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 571
Number of extensions: 23
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 572
Length of database: 476
Length adjustment: 35
Effective length of query: 537
Effective length of database: 441
Effective search space:   236817
Effective search space used:   236817
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory