GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gabD in Pseudomonas putida KT2440

Align succinate-semialdehyde dehydrogenase (NADP+) (EC 1.2.1.79) (characterized)
to candidate PP_4422 PP_4422 succinate-semialdehyde dehydrogenase (NADP+)

Query= BRENDA::P25526
         (482 letters)



>lcl|FitnessBrowser__Putida:PP_4422 PP_4422 succinate-semialdehyde
           dehydrogenase (NADP+)
          Length = 490

 Score =  494 bits (1273), Expect = e-144
 Identities = 245/480 (51%), Positives = 324/480 (67%), Gaps = 2/480 (0%)

Query: 2   KLNDSNLFRQQALINGEWLDANNGEAIDVTNPANGDKLGSVPKMGADETRAAIDAANRAL 61
           KL  ++L   +A I+G W+      ++DVT+PAN   +  V          A++AA+RA 
Sbjct: 11  KLRRNDLLETRAYIDGRWVTGEG--SLDVTDPANDQVIAQVAHCDESWVDLAVEAASRAF 68

Query: 62  PAWRALTAKERATILRNWFNLMMEHQDDLARLMTLEQGKPLAEAKGEISYAASFIEWFAE 121
             WR     +R  +LR W  LM E+Q+DLA +MT EQGKPL+E++GEI+Y A+F+EWFA 
Sbjct: 69  DGWRNTLPTQRGAVLRKWAALMRENQEDLAVIMTCEQGKPLSESRGEINYGANFVEWFAA 128

Query: 122 EGKRIYGDTIPGHQADKRLIVIKQPIGVTAAITPWNFPAAMITRKAGPALAAGCTMVLKP 181
           EG+R YG+TIP H  + +L+   QPIGVT AITPWNFP+AMITRKA  ALAAGC M++KP
Sbjct: 129 EGERCYGETIPSHLPNSQLVTKLQPIGVTVAITPWNFPSAMITRKAAAALAAGCPMIVKP 188

Query: 182 ASQTPFSALALAELAIRAGVPAGVFNVVTGSAGAVGNELTSNPLVRKLSFTGSTEIGRQL 241
           A +TP SALALA LA  AG+P GVF V+TG A  +   L +   VR  SFTGSTE+GR L
Sbjct: 189 APETPLSALALARLAEEAGIPGGVFQVLTGDAPKMSARLLAASAVRAFSFTGSTEVGRIL 248

Query: 242 MEQCAKDIKKVSLELGGNAPFIVFDDADLDKAVEGALASKFRNAGQTCVCANRLYVQDGV 301
           + Q A  +KKVSLELGG+APFIVFDDA + +AVEG + +KF  +GQ C+ ANR+YV   +
Sbjct: 249 LRQSADTVKKVSLELGGHAPFIVFDDASIAEAVEGCIGAKFATSGQDCLGANRIYVHRNI 308

Query: 302 YDRFAEKLQQAVSKLHIGDGLDNGVTIGPLIDEKAVAKVEEHIADALEKGARVVCGGKAH 361
           Y +F E+  +A  KL +G GL+ GV IGP+       K  E I++AL  GA++ CGG  +
Sbjct: 309 YGQFVEEFTKATEKLRVGHGLEEGVDIGPMTRVTVANKCREQISNALSLGAKLTCGGIDN 368

Query: 362 ERGGNFFQPTILVDVPANAKVSKEETFGPLAPLFRFKDEADVIAQANDTEFGLAAYFYAR 421
             G +F  PT+L DV     ++ EETFGP+A +  F  E +V+ +AN+TEFGLAAY Y  
Sbjct: 369 HLGSSFVLPTVLADVTDKMDIAFEETFGPVAAILPFDSEDEVVTRANNTEFGLAAYVYTN 428

Query: 422 DLSRVFRVGEALEYGIVGINTGIISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYMCIG 481
           DL R  RV + LEYG+V +NT   +    PFGG K SGLGREGSK+G+ +Y+E+KY+CIG
Sbjct: 429 DLRRACRVSDRLEYGMVALNTPKFTGAPIPFGGWKQSGLGREGSKHGLAEYMELKYVCIG 488


Lambda     K      H
   0.318    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 622
Number of extensions: 18
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 482
Length of database: 490
Length adjustment: 34
Effective length of query: 448
Effective length of database: 456
Effective search space:   204288
Effective search space used:   204288
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory