Align spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized)
to candidate PP_1722 PP_1722 ABC transporter, ATP-binding protein
Query= CharProtDB::CH_024626 (378 letters) >FitnessBrowser__Putida:PP_1722 Length = 329 Score = 276 bits (705), Expect = 8e-79 Identities = 157/337 (46%), Positives = 212/337 (62%), Gaps = 33/337 (9%) Query: 18 VQLAGIRKCFDGKEVIPQLDLTINNGEFLTLLGPSGCGKTTVLRLIAGLETVDSGRIMLD 77 V + ++K + G V ++D I GEF+TLLGPSGCGK+T+LR IAGL +VDSG+I+LD Sbjct: 4 VSVQKLQKSYAGSPVFERIDCHIERGEFVTLLGPSGCGKSTLLRCIAGLTSVDSGQILLD 63 Query: 78 NEDITHVPAENRYVNTVFQSYALFPHMTVFENVAFGLRMQKTPAAEITPRVMEALRMVQL 137 DI + + R + VFQSYALFP+MTV +NVAFGLRMQK A E RV E L +V+L Sbjct: 64 GHDIVPLSPQKRGIGMVFQSYALFPNMTVEQNVAFGLRMQKVKADESQLRVREVLELVEL 123 Query: 138 ETFAQRKPHQLSGGQQQRVAIARAVVNKPRLLLLDESLSALDYKLRKQMQNELKALQRKL 197 FA R PHQLSGGQ QRVA+AR++V +PRLLLLDE LSALD ++RK ++ +++A+QR+L Sbjct: 124 GKFAGRYPHQLSGGQCQRVALARSLVTRPRLLLLDEPLSALDARIRKHLREQIRAIQREL 183 Query: 198 GITFVFVTHDQEEALTMSDRIVVMRDGRIEQDGTPREIYEEPKNLFVAGFIGEINMFNAT 257 G+T +FVTHDQEEALTMSDRI +M GRI Q G +Y P +LF AGFIG N+ +A Sbjct: 184 GLTTIFVTHDQEEALTMSDRIFLMNQGRIVQSGDAETLYTAPVDLFAAGFIGNYNLLDAD 243 Query: 258 VIERLDEQRVRANVEGRECNIYVNFAVEPGQKLHVLLRPEDLRV---EEINDDNHAEGLI 314 RL ++ V + + +RPE + + E++ + + L+ Sbjct: 244 SASRLLQRPVAS---------------------RLAIRPESITLGEHGELDAEVRSHSLL 282 Query: 315 GYVRERNYKGMTLESVVELEN---------GKMVMVS 342 G V + +E VV++ N GK V VS Sbjct: 283 GNVIRYRVRVREVELVVDVLNRSPADLHADGKRVSVS 319 Lambda K H 0.319 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 378 Length of database: 329 Length adjustment: 29 Effective length of query: 349 Effective length of database: 300 Effective search space: 104700 Effective search space used: 104700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory