Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate PP_3817 PP_3817 Polyamine ABC transporter, ATP-binding protein
Query= TCDB::P31134 (377 letters) >FitnessBrowser__Putida:PP_3817 Length = 382 Score = 263 bits (671), Expect = 8e-75 Identities = 155/360 (43%), Positives = 215/360 (59%), Gaps = 12/360 (3%) Query: 19 LLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIML 78 L+ +R L K Y AVD++ L I GE LG+SG GKST L MLAGFE PS+G+I++ Sbjct: 14 LVSLRGLNKHYGDFTAVDNLDLEIQDGEFLTFLGSSGSGKSTTLSMLAGFETPSSGEILV 73 Query: 79 DGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLVH 138 DG L VPP+ R I M+FQ Y+LFPH+ V NIAF L KL AE A RV+ ML LV Sbjct: 74 DGQSLVNVPPHKRDIGMVFQRYSLFPHLNVRDNIAFPLAIRKLGAAETAKRVDAMLKLVQ 133 Query: 139 MQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILER 198 +++FA RKP Q+SGGQ+QRVA+AR+L P++LL+DEP+GALDKKLR+ +Q E+ + R Sbjct: 134 LEQFAHRKPSQMSGGQQQRVAIARALVYEPRILLMDEPLGALDKKLREDLQDELRQLHRR 193 Query: 199 VGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEG 258 +G+T V VTHDQEEAM ++ RIAI + GK V +G ++Y++P + A F+G+ N F Sbjct: 194 LGITIVYVTHDQEEAMRLSQRIAIFSHGKIVGLGTGYDLYQNPPNAFVASFLGNSN-FLR 252 Query: 259 VLKERQEDGLVLDSP---GLVHPLKVDADASVVDNVPVHVALRPEKIMLCEEPPANGCNF 315 + G P L L DA ++ VA+ E+ M EP G N Sbjct: 253 IKASSNGAGSFEGQPVAIRLTPGLAASQDALIMVRPEKAVAMSAEQAM--REPLPAGWNE 310 Query: 316 AVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPTW-GDEVRLCWEV-DSCV 373 +V + +LG+ HV G ++ + +A G+P GD V++ W V D+C+ Sbjct: 311 VTAKVGEVLFLGESQTCHVVTAGGTELTVKALSA----AGMPMQPGDSVKVRWAVADACI 366 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 382 Length adjustment: 30 Effective length of query: 347 Effective length of database: 352 Effective search space: 122144 Effective search space used: 122144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory