Align Putrescine importer PuuP (characterized)
to candidate PP_2586 PP_2586 putative amino acid transporter
Query= SwissProt::P76037 (461 letters) >FitnessBrowser__Putida:PP_2586 Length = 460 Score = 328 bits (842), Expect = 2e-94 Identities = 179/443 (40%), Positives = 270/443 (60%), Gaps = 9/443 (2%) Query: 11 AQPGKT--RLRKSLKLWQVVMMGLAYLTPMTVFDTFGIVSGISDGHVPASYLLALAGVLF 68 +QPG + R RKS+ + +V+ GLAY+ P+ VF T+G+V+ ++ GH+P +YLL LA +L Sbjct: 17 SQPGTSTGRFRKSMSMTALVLFGLAYMVPLAVFTTYGLVTQMTKGHLPTAYLLTLAAMLL 76 Query: 69 TAISYGKLVRQFPEAGSAYTYAQKSINPHVGFMVGWSSLLDYLFLPMINVLLAKIYLSAL 128 TA SYG++V+ P +GS YTY +K+ H+GF+ GW+ LLDY+FLP+++ LL IY+S Sbjct: 77 TAYSYGRMVQAHPYSGSVYTYTRKAFGSHIGFITGWTLLLDYIFLPLLSYLLIGIYMSEY 136 Query: 129 FPEVPPWVWVVTFVAILTAANLKSVNLVANFNTLFVLVQISIMVVFIFLVVQGLHKGEGV 188 FP + WVWV +A++T NL + + N + V+VQ+ ++VF+ L + L G Sbjct: 137 FPTIHAWVWVAGSIALVTFLNLIGIESITRVNWILVVVQLVFIIVFVALSILKL---SGQ 193 Query: 189 GTVWSLQPFISENAHLIPII-TGATIVCFSFLGFDAVTTLSEETPDAARVIPKAIFLTAV 247 SL + + +P+I TGA ++C SFLGFDAV+T++EET + IP AI ++ Sbjct: 194 AEPVSLLAPLHHDGFSVPLIMTGAAVLCLSFLGFDAVSTMAEETSNPTYRIPVAILAVSL 253 Query: 248 YGGVIFIAASFFMQLFFPDISRFKDPDAALPEIALYVGGKLFQSIFLCTTFVNTLASGLA 307 GG++F+ S+ Q+ FPD F DPD+A ++ VGG+L + F T AS + Sbjct: 254 IGGLLFLVVSYCAQMVFPDWGSFADPDSASVDVMRRVGGELLVTAFTATYVAGCFASAMV 313 Query: 308 SHASVSRLLYVMGRDNVFPERVFGYVHPKWRTPALNVIMVGIVALSALFFDLVTATALIN 367 S ASVSR+L+ MGRD P R FG + K R PA +++V +++L AL L T +I+ Sbjct: 314 SQASVSRVLFAMGRDGALP-RAFGQLVTKKRVPATAILVVSLLSLIALVITLDTVANMIS 372 Query: 368 FGALVAFTFVNLSVFNHFWRRKGMNKSWKDHFHYLLMPLVGALTVGVLWVNLESTSLTLG 427 FGAL AF+ VNL+V H+ + + + ++ Y +P +G L+ LW +L S S T+G Sbjct: 373 FGALFAFSAVNLAVVKHYLVDQKL-RGCRNCLLYGAIPGLGFLSTLWLWSSLTSLSFTIG 431 Query: 428 LVWASLGGAYLWYLIRRYR-KVP 449 L W LG L L R R K+P Sbjct: 432 LCWMGLGLLVLLGLTRALRVKLP 454 Lambda K H 0.328 0.141 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 611 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 460 Length adjustment: 33 Effective length of query: 428 Effective length of database: 427 Effective search space: 182756 Effective search space used: 182756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory