GapMind for catabolism of small carbon sources

 

Aligments for a candidate for actP in Pseudomonas putida KT2440

Align Acetate permease; SubName: Full=Actetate permease; SubName: Full=Cation acetate symporter; SubName: Full=Cation/acetate symporter (characterized, see rationale)
to candidate PP_2797 PP_2797 acetate permease

Query= uniprot:A0A1N7U9G2
         (552 letters)



>lcl|FitnessBrowser__Putida:PP_2797 PP_2797 acetate permease
          Length = 552

 Score =  657 bits (1696), Expect = 0.0
 Identities = 319/526 (60%), Positives = 416/526 (79%), Gaps = 3/526 (0%)

Query: 30  KQPLNVSAIVMFVVFVGATLCITYWASKRNKSAADYYAAGGKITGFQNGLAIAGDYMSAA 89
           +QPLN+ AI MF+VFV  TLCIT+WA++R +S  D+Y+AGG I G+QNGLA+AGDYMSA+
Sbjct: 27  RQPLNLHAIGMFMVFVLFTLCITWWAARRTRSTTDFYSAGGGIQGWQNGLALAGDYMSAS 86

Query: 90  SFLGISALVYTSGYDGLIYSIGFLVGWPIILFLIAERLRNLGKYTFADVASYRLGQTQIR 149
           + LGI+AL+YTSG DG IY I F  GWP++L L+ ERLRNLG++TFAD+ SYRL Q ++R
Sbjct: 87  TLLGITALIYTSGMDGYIYLIAFFAGWPVLLLLMTERLRNLGRFTFADITSYRLDQGKVR 146

Query: 150 SLSACGSLVVVAFYLIAQMVGAGKLIQLLFGLDYHVAVILVGILMVLYVLFGGMLATTWV 209
           +++A GSL VV FYL+AQMVGAG+LI+LLFGLDYH+AV++VG LM+LYV FGGM+ATTWV
Sbjct: 147 TMAAIGSLTVVCFYLVAQMVGAGQLIRLLFGLDYHIAVVIVGALMMLYVTFGGMVATTWV 206

Query: 210 QIIKAVLLLSGASFMALMVMKHVNFDFNALFSEAIKVHPKGEAIMSPGGLVKDPISAFSL 269
           QIIKA LLL G S +  + M+  +F ++AL S+A+  H  GE +++PG L+ DP++A SL
Sbjct: 207 QIIKAFLLLVGGSLVLFLAMREFDFSYDALVSKAMDTHALGERLLAPGSLLADPLTALSL 266

Query: 270 GLALMFGTAGLPHILMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVSTNP 329
            L L+FGTAGLPHILMRFFTVSDA+EARKSV YATGFIGYF+ + F++G  +I++VS  P
Sbjct: 267 SLGLVFGTAGLPHILMRFFTVSDAREARKSVLYATGFIGYFFNVIFLLGLASIVIVSQQP 326

Query: 330 AF---KDAAGALMGGNNMAAVHLANAVGGSIFLGFISAVAFATILAVVAGLTLAGASAVS 386
            F    +  G L+GG NM  +HLA AVGG++ LGF+SAV FATILAVV+GL LAGASA++
Sbjct: 327 KFFEGGEVGGKLLGGGNMVVMHLAQAVGGNLLLGFLSAVTFATILAVVSGLALAGASAIA 386

Query: 387 HDLYASVIKKGKANDKDEIRVSKITTIALGVLAIGLGILFESQNIAFMVGLAFSIAASCN 446
           HDLYA VI KG A++  E+RV+K+ T++LG++AI LGILFE+ N+AFMV LAF IAAS N
Sbjct: 387 HDLYARVIMKGAASEAQELRVTKLATLSLGLVAIALGILFENINVAFMVALAFGIAASAN 446

Query: 447 FPVLLLSMYWKNLTTRGAMIGGWLGLVSAVGLMVLGPTIWVSILHHEKAIFPYEYPALFS 506
           FPVL LSM+W  LTTRGA+  G++GL+SA+G +V    +WV +LH  + +FPY  PALFS
Sbjct: 447 FPVLFLSMFWSGLTTRGALAAGYVGLLSAMGFVVFSKLVWVDVLHFAEPLFPYTQPALFS 506

Query: 507 MIIAFVGIWFFSITDKSSAAEKERALYFPQFVRSQTGLGSSGAVSH 552
           M +AF+  +  S  D+++ A+ ERA +  QFVR QTGLG+SGAV H
Sbjct: 507 MPLAFLVAYAVSRMDRTARAKAERAAFADQFVRGQTGLGASGAVDH 552


Lambda     K      H
   0.327    0.140    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 934
Number of extensions: 49
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 552
Length of database: 552
Length adjustment: 36
Effective length of query: 516
Effective length of database: 516
Effective search space:   266256
Effective search space used:   266256
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory