GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mctC in Pseudomonas putida KT2440

Align Monocarboxylic acid transporter (characterized)
to candidate PP_1743 PP_1743 acetate permease

Query= SwissProt::Q8NS49
         (551 letters)



>lcl|FitnessBrowser__Putida:PP_1743 PP_1743 acetate permease
          Length = 554

 Score =  439 bits (1130), Expect = e-127
 Identities = 249/557 (44%), Positives = 343/557 (61%), Gaps = 37/557 (6%)

Query: 8   AQDAVSEGVGNPILNIS---VFVVFIIVTMTVVLRVGKSTSESTDFYTGGASFSGTQNGL 64
           A DA++  V    LN+S   +FV F+  T+ +     K    ++D+Y  G   +G QNGL
Sbjct: 22  AADALTGEVQKQPLNVSAIAMFVAFVAFTLGITYWASKRNKSASDYYAAGGKITGFQNGL 81

Query: 65  AIAGDYLSAASFLGIVGAISLNGYDGFLYSIGFFVAWLVALLLVAEPLRNVGRFTMADVL 124
           AIAGDY+SAASFLGI   +  +GYDG +YSIGF V W + L L+AE LRN+G++T ADV 
Sbjct: 82  AIAGDYMSAASFLGISALVFTSGYDGLIYSIGFLVGWPIILFLIAERLRNLGKYTFADVA 141

Query: 125 SFRLRQKPVRVAAACGTLAVTLFYLIAQMAGAGSLVSVL--LDIHEFKWQAVVVGIVGIV 182
           S+RL QK +R  +A G+L V  FYLIAQM GAG L+ +L  LD H      V V +VGI+
Sbjct: 142 SYRLGQKEIRTLSASGSLVVVAFYLIAQMVGAGKLIELLFGLDYH------VAVILVGIL 195

Query: 183 MIAYVLLGGMKGTTYVQMIKAVLLVGGVAIMTVLTFVKVSGGLTTLLNDAVEKHAASDYA 242
           M  YVL GGM  TT+VQ+IKAVLL+ G + M ++    V     TL ++A++ HA  +  
Sbjct: 196 MCLYVLFGGMLATTWVQIIKAVLLLSGASFMALMVMKHVGFDFNTLFSEAIKVHAKGE-- 253

Query: 243 ATKGYDPTQILEPGLQYGATLTTQLDFISLALALCLGTAGLPHVLMRFYTVPTAKEARKS 302
                    I+ P    G  +   +   SL LAL  GTAGLPH+LMRF+TV  AKEARKS
Sbjct: 254 --------AIMSP----GGLVKDPISAFSLGLALMFGTAGLPHILMRFFTVSDAKEARKS 301

Query: 303 VTWAIVLIGAFYLMTLVLGYGAAALVG-----PDRVIAAPGAANAAAPLLAFELGGSIFM 357
           V +A   IG FY++T ++G+GA  LV       D   A  G  N AA  LA  +GGS+F+
Sbjct: 302 VLYATGFIGYFYILTFIIGFGAILLVSTNPEFKDAAGALLGGNNMAAVHLANAVGGSVFL 361

Query: 358 ALISAVAFATVLAVVAGLAITASAAVGHDIYNAVIRNGQSTEAEQVRVSRITVVVIGLIS 417
             ISAVAFAT+LAVVAGL +  ++AV HD+Y +V R G++ + +++RVS+IT V +G+++
Sbjct: 362 GFISAVAFATILAVVAGLTLAGASAVSHDLYASVWRKGKANDKDEIRVSKITTVALGVLA 421

Query: 418 IVLGILAMTQNVAFLVALAFAVAASANLPTILYSLYWKKFNTTGAVAAIYTGLISALLLI 477
           I LGIL   QN+AF+V LAF++AAS N P +L S+YWKK  T GA+   + GL+SA+ L+
Sbjct: 422 IGLGILFEKQNIAFMVGLAFSIAASCNFPVLLLSMYWKKLTTRGAMIGGWLGLVSAVTLM 481

Query: 478 FLSPAVSGNDSAMVPGADWAIFPLKNPGLVSIPLAFIAGWIGTLVGKPDNMDD---LAAE 534
            L P +       + G +  I+P + P L S+ +AF++ W  ++  K    +D   L   
Sbjct: 482 ILGPTI----WVQILGHEKPIYPYEYPALFSMAIAFVSIWFFSVTDKSKAAEDERALFFP 537

Query: 535 MEVRSLTGVGVEKAVDH 551
             VRS TG+G   AV H
Sbjct: 538 QFVRSQTGLGASGAVSH 554


Lambda     K      H
   0.324    0.138    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 700
Number of extensions: 34
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 551
Length of database: 554
Length adjustment: 36
Effective length of query: 515
Effective length of database: 518
Effective search space:   266770
Effective search space used:   266770
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory