GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mctC in Pseudomonas putida KT2440

Align Monocarboxylic acid transporter (characterized)
to candidate PP_2797 PP_2797 acetate permease

Query= SwissProt::Q8NS49
         (551 letters)



>lcl|FitnessBrowser__Putida:PP_2797 PP_2797 acetate permease
          Length = 552

 Score =  385 bits (988), Expect = e-111
 Identities = 232/571 (40%), Positives = 332/571 (58%), Gaps = 49/571 (8%)

Query: 1   MNSTILLAQDAVSEGVGNPIL--NISVFVVFIIVTMTVVLRVGKSTSESTDFYTGGASFS 58
           ++S +LLA  ++  G   P+    I +F+VF++ T+ +     + T  +TDFY+ G    
Sbjct: 11  LHSGLLLASPSLDAGQRQPLNLHAIGMFMVFVLFTLCITWWAARRTRSTTDFYSAGGGIQ 70

Query: 59  GTQNGLAIAGDYLSAASFLGIVGAISLNGYDGFLYSIGFFVAWLVALLLVAEPLRNVGRF 118
           G QNGLA+AGDY+SA++ LGI   I  +G DG++Y I FF  W V LLL+ E LRN+GRF
Sbjct: 71  GWQNGLALAGDYMSASTLLGITALIYTSGMDGYIYLIAFFAGWPVLLLLMTERLRNLGRF 130

Query: 119 TMADVLSFRLRQKPVRVAAACGTLAVTLFYLIAQMAGAGSLVSVL--LDIHEFKWQAVVV 176
           T AD+ S+RL Q  VR  AA G+L V  FYL+AQM GAG L+ +L  LD H      + V
Sbjct: 131 TFADITSYRLDQGKVRTMAAIGSLTVVCFYLVAQMVGAGQLIRLLFGLDYH------IAV 184

Query: 177 GIVGIVMIAYVLLGGMKGTTYVQMIKAVLLVGGVAIMTVLTFVKVSGGLTTLLNDAVEKH 236
            IVG +M+ YV  GGM  TT+VQ+IKA LL+ G +++  L   +       L++ A++ H
Sbjct: 185 VIVGALMMLYVTFGGMVATTWVQIIKAFLLLVGGSLVLFLAMREFDFSYDALVSKAMDTH 244

Query: 237 AASDYAATKGYDPTQILEPGLQYGATLTTQLDFISLALALCLGTAGLPHVLMRFYTVPTA 296
           A  +          ++L P    G+ L   L  +SL+L L  GTAGLPH+LMRF+TV  A
Sbjct: 245 ALGE----------RLLAP----GSLLADPLTALSLSLGLVFGTAGLPHILMRFFTVSDA 290

Query: 297 KEARKSVTWAIVLIGAFYLMTLVLGYGAAALV--------GPDRVIAAPGAANAAAPLLA 348
           +EARKSV +A   IG F+ +  +LG  +  +V        G +      G  N     LA
Sbjct: 291 REARKSVLYATGFIGYFFNVIFLLGLASIVIVSQQPKFFEGGEVGGKLLGGGNMVVMHLA 350

Query: 349 FELGGSIFMALISAVAFATVLAVVAGLAITASAAVGHDIYNAVIRNGQSTEAEQVRVSRI 408
             +GG++ +  +SAV FAT+LAVV+GLA+  ++A+ HD+Y  VI  G ++EA+++RV+++
Sbjct: 351 QAVGGNLLLGFLSAVTFATILAVVSGLALAGASAIAHDLYARVIMKGAASEAQELRVTKL 410

Query: 409 TVVVIGLISIVLGILAMTQNVAFLVALAFAVAASANLPTILYSLYWKKFNTTGAVAAIYT 468
             + +GL++I LGIL    NVAF+VALAF +AASAN P +  S++W    T GA+AA Y 
Sbjct: 411 ATLSLGLVAIALGILFENINVAFMVALAFGIAASANFPVLFLSMFWSGLTTRGALAAGYV 470

Query: 469 GLISALLLIFLSPAVSGNDSAMVPGADWA--IFPLKNPGLVSIPLAFIAGWIGTLVGKPD 526
           GL+SA+  +  S  V       V    +A  +FP   P L S+PLAF+  +    V + D
Sbjct: 471 GLLSAMGFVVFSKLV------WVDVLHFAEPLFPYTQPALFSMPLAFLVAY---AVSRMD 521

Query: 527 NMDDLAAEME------VRSLTGVGVEKAVDH 551
                 AE        VR  TG+G   AVDH
Sbjct: 522 RTARAKAERAAFADQFVRGQTGLGASGAVDH 552


Lambda     K      H
   0.324    0.138    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 644
Number of extensions: 31
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 551
Length of database: 552
Length adjustment: 36
Effective length of query: 515
Effective length of database: 516
Effective search space:   265740
Effective search space used:   265740
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory