Align L-rhamnose 1-dehydrogenase (NADP(+)); RHAD; EC 1.1.1.377 (characterized)
to candidate PP_1852 PP_1852 putative enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific)
Query= SwissProt::Q9HK58 (254 letters) >FitnessBrowser__Putida:PP_1852 Length = 249 Score = 118 bits (296), Expect = 1e-31 Identities = 81/251 (32%), Positives = 127/251 (50%), Gaps = 13/251 (5%) Query: 2 LDFKGKNAVITGGSRGIGRAIALGLAKQGANILISYASHDSEADEVLETASKYGVKAHKV 61 L +GK A++ GGSRGIG AI LA++GA + +Y S A+E+ ++ G KA + Sbjct: 5 LTLEGKVALVQGGSRGIGAAIVRRLAREGAQVAFTYVSSAGPAEELAREITENGGKALAL 64 Query: 62 KVDQSDPYESIRFAEKAIETFGKVHILVDNAGICPFEDFFRISVDLFEKVWKVNVESHYF 121 + D +D + + G++ ILV+NAG+ + F+ + VNV S + Sbjct: 65 RADSADAAAVQLAVDDTEKALGRLDILVNNAGVLAVAPVTEFDLADFDHMLAVNVRSVFV 124 Query: 122 ITQRIAKNMIENKINGRILLISSISAH----VGGEFQTHYTTTKSALNGFMHSIAIVLGK 177 +Q A+ M + GRI+ I S +A GG Y +KSAL G +A LG Sbjct: 125 ASQAAARYMGQ---GGRIINIGSTNAERMPFAGG---APYAMSKSALVGLTRGMARDLGP 178 Query: 178 YGILVNSLEPGTILTDINKEDLSNQEKRAYMERRTVVGRLGLPEDMVAPALFLLSDDNTY 237 GI VN+++PG + TD+N ++ E + +GR G PE++ + +L + Y Sbjct: 179 QGITVNNVQPGPVDTDMNP---ASGEFAESLIPLMAIGRYGEPEEIASFVAYLAGPEAGY 235 Query: 238 VTGTELLADGG 248 +TG L DGG Sbjct: 236 ITGASLTVDGG 246 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 249 Length adjustment: 24 Effective length of query: 230 Effective length of database: 225 Effective search space: 51750 Effective search space used: 51750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory