Align L-rhamnose-1-dehydrogenase; EC 1.1.1.173 (characterized)
to candidate PP_2794 PP_2794 Oxidoreductase, short chain dehydrogenase/reductase family
Query= SwissProt::A3LZU7 (258 letters) >FitnessBrowser__Putida:PP_2794 Length = 255 Score = 128 bits (322), Expect = 1e-34 Identities = 87/248 (35%), Positives = 131/248 (52%), Gaps = 9/248 (3%) Query: 5 LNGKVVAITGGVTGIGRAIAIEMARNGAKVVVNHLPSEEQAQLAKELKEEISDGENNVLT 64 L+G+ +TG +G+GR A+ +A GA+VVV + QA L + L E I Sbjct: 11 LDGRRALVTGASSGLGRHFAMTLAAAGAEVVVT---ARRQAPL-QALVEAIEVAGGRAQA 66 Query: 65 IPGDISLPETGRRIVELAVEKFGEINVFVSNAGVCGFREFLEITPETLFQTVNINLNGAF 124 D++ E R+++ A G ++V V+NAGV + L +T ++ NL GA+ Sbjct: 67 FALDVTSREDICRVLDAA----GPLDVLVNNAGVSDSQPLLACDDQTWDHVLDTNLKGAW 122 Query: 125 FAIQAAAQQMVKQGKGGSIIGISSISALVGGAHQTHYTPTKAGILSLMQSTACALGKYGI 184 Q +A++MV GKGGS+I ++SI A Y KAG+ L ++ A L ++GI Sbjct: 123 AVAQESARRMVVAGKGGSLINVTSILASRVAGAVGPYLAAKAGLAHLTRAMALELARHGI 182 Query: 185 RCNAILPGTISTALNEEDLKDPEKRKYMEGRIPLGRVGDPKDIAGPAIFLASDMSNYVNG 244 R NA+ PG + T LNE L E + RIP R P D+ G + LASD ++G Sbjct: 183 RVNALAPGYVMTDLNEAFLAS-EAGDKLRSRIPSRRFSVPSDLDGALLLLASDAGRAMSG 241 Query: 245 AQLLVDGG 252 A+++VDGG Sbjct: 242 AEIVVDGG 249 Lambda K H 0.317 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 255 Length adjustment: 24 Effective length of query: 234 Effective length of database: 231 Effective search space: 54054 Effective search space used: 54054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory