Align LacI family transcriptional regulator (characterized, see rationale)
to candidate PP_2454 PP_2454 ribose ABC transporter, periplasmic ribose-binding subunit
Query= uniprot:A0A161ZH48 (318 letters) >FitnessBrowser__Putida:PP_2454 Length = 319 Score = 462 bits (1189), Expect = e-135 Identities = 238/319 (74%), Positives = 283/319 (88%), Gaps = 3/319 (0%) Query: 1 MKLPFAGRLLAVAMLAAASAALPVSSAFAETPEKPKVALVMKSLANEFFLTMEDGAKAYQ 60 MKLPF GRLLA+A++++ S ALP+S+A AE +KPKVALVMKSLANEFF TMEDGAK YQ Sbjct: 1 MKLPFPGRLLALAVISSLSLALPLSAAHAE--DKPKVALVMKSLANEFFRTMEDGAKDYQ 58 Query: 61 KDHSGDFELISNGIKDETDTAGQTRIVEQMILSKVNALVIAPADSKAMVPVIKKAVDAGI 120 K H+ +FELI+NGIK+ETDT Q RIVEQM+ + ALVIAPADSKA+V +KKA+D G+ Sbjct: 59 KTHADEFELIANGIKNETDTGEQIRIVEQMVNAGAKALVIAPADSKALVSAVKKAMDQGV 118 Query: 121 TVINIDNQLDPAVVKSKNITVPFVGPDNRKGARLVGEYLAKQ-LKAGDEVGIIEGVSTTT 179 VINIDN+LDP ++KSK I+VPFVGPDNRKGARLVG+YLA Q LKAGD+VGIIEGVSTTT Sbjct: 119 VVINIDNRLDPDLLKSKGISVPFVGPDNRKGARLVGDYLASQKLKAGDQVGIIEGVSTTT 178 Query: 180 NAQQRTAGFKDAMEAAQIKVVSLQSGDWEIDKGGKVASSMLSEYPNIKALLAGNDSMAVG 239 NAQQRTAGFKDAM+AAQ+K+VS+QSG+WEIDKG VA+SML+EYP++KALLAGNDSMA+G Sbjct: 179 NAQQRTAGFKDAMDAAQMKIVSVQSGNWEIDKGNAVAASMLNEYPDLKALLAGNDSMALG 238 Query: 240 AVSAVRAAGKAGKVQVVGYDNINAIKPMLKDGRVLATADQFAARQAVFGIETALKIIKGE 299 AVSAVRAAGK G+VQVVGYDNINAIKPML+DGRVLAT DQ A++QAV+GI+ ALK++KGE Sbjct: 239 AVSAVRAAGKTGQVQVVGYDNINAIKPMLEDGRVLATLDQAASQQAVYGIQAALKMVKGE 298 Query: 300 TVDSGANGVIETPVELVTK 318 D A+ VI+TPVEL+TK Sbjct: 299 KPDVDADNVIQTPVELITK 317 Lambda K H 0.314 0.130 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 319 Length adjustment: 27 Effective length of query: 291 Effective length of database: 292 Effective search space: 84972 Effective search space used: 84972 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory