Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate PP_2767 PP_2767 putative Branched-chain amino acid ABC transporter, ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >FitnessBrowser__Putida:PP_2767 Length = 277 Score = 207 bits (527), Expect = 2e-58 Identities = 108/253 (42%), Positives = 159/253 (62%), Gaps = 1/253 (0%) Query: 5 SNEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAG 64 SN +L++ GIS F G++A+SD+G ++ G++ LIGPNGAGK++ N+I G+Y G Sbjct: 2 SNLPLLELEGISLSFKGVKAISDIGFSVAEGEICALIGPNGAGKSSLLNIINGVYRAQQG 61 Query: 65 TFELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRT 124 AG+ H A+ GIARTFQNI LF M+ L+NV+ GR+++ S R Sbjct: 62 RIRFAGQQRRVMHPHAAARDGIARTFQNIALFKGMSVLDNVLTGRNLKRRSSWLEQALRI 121 Query: 125 KGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEP 184 E+ A+ +++++ I + D TL YG Q+R+E+ARALA +P+L+ LDEP Sbjct: 122 GRAPGEDDRQRAAAERVIEFLRIQPWRDEIVGTLPYGLQKRIELARALAAEPRLLLLDEP 181 Query: 185 AAGMNATEKVQLRELIDRI-RNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAE 243 AGMNA EK ++ I I R T++LIEHD+ +VMG+ V VLDYG++I +G+P + Sbjct: 182 MAGMNAEEKREMSRFIVEINREFGMTVVLIEHDIGVVMGISHHVVVLDYGRKIGDGSPEQ 241 Query: 244 VQKNEKVIEAYLG 256 V++N VI AYLG Sbjct: 242 VRRNPDVIAAYLG 254 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 277 Length adjustment: 25 Effective length of query: 235 Effective length of database: 252 Effective search space: 59220 Effective search space used: 59220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory