Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate PP_1946 PP_1946 Oxidoreductase, short chain dehydrogenase/reductase family
Query= BRENDA::Q1J2J0 (255 letters) >FitnessBrowser__Putida:PP_1946 Length = 262 Score = 149 bits (377), Expect = 4e-41 Identities = 97/252 (38%), Positives = 139/252 (55%), Gaps = 16/252 (6%) Query: 14 FRLDGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAAREL-----DGTFER 68 + G+ LVTG GIG A AQ+GA V +AD++ D G + + TF Sbjct: 5 YDFSGKVVLVTGAGSGIGRATALAFAQSGASVAVADISTDHGLKTVELVKAEGGEATFFH 64 Query: 69 LNVTDADAV----ADLARRLPDVDVLVNNAGIVRN-APAEDTPDDDWRAVLSVNLDGVFW 123 ++V +V A + +D+ NNAGI N P + D+WR V+ VNL VF+ Sbjct: 65 VDVGSEPSVQSMLAGVVAHYGGLDIAHNNAGIEANIVPLAELDSDNWRRVIDVNLSSVFY 124 Query: 124 CCREFGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGV 183 C + ML RG GAIV+TAS SGLI + + Y A+K V+ LT++ A ++A++ + Sbjct: 125 CLKGEIPLMLKRGGGAIVNTASASGLIGGY--RLSGYTATKHGVVGLTKAAAIDYANQNI 182 Query: 184 RVNAVAPGYTATPLTRRGLETPE-WRETWLKETPLGRLAEPREIAPAVLYLASDAASFVT 242 R+NAV PG +P + P+ R+ L TP+GRLA EIA +VL+L SD A +V Sbjct: 183 RINAVCPGPVDSPFL---ADMPQPMRDRLLFGTPIGRLATAEEIARSVLWLCSDDAKYVV 239 Query: 243 GHTLVVDGGYTV 254 GH++ VDGG V Sbjct: 240 GHSMSVDGGVAV 251 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 262 Length adjustment: 24 Effective length of query: 231 Effective length of database: 238 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory