Align 1-phosphofructokinase (EC 2.7.1.56) (characterized)
to candidate PP_0794 PP_0794 1-phosphofructokinase monomer
Query= reanno::pseudo5_N2C3_1:AO356_07330 (313 letters) >FitnessBrowser__Putida:PP_0794 Length = 315 Score = 412 bits (1059), Expect = e-120 Identities = 214/313 (68%), Positives = 242/313 (77%), Gaps = 3/313 (0%) Query: 1 MAKILTLTLNPALDLTVELARLEPGQVNRSDAMHAHAAGKGVNVAQVLADLGHTLTVSGF 60 MAKILTLTLNPALD+T+ L L PGQVNRS A H+HAAGKG+NVAQVLADLGH++TV GF Sbjct: 1 MAKILTLTLNPALDITIGLDTLRPGQVNRSQAQHSHAAGKGLNVAQVLADLGHSVTVGGF 60 Query: 61 LGEDNAQVFETLFAQRGFVDAFIRVPGETRSNIKLAEQDGRITDLNGPGPMVDAAAQQAL 120 LG DN Q FE L RGF D F+RVPGETRSNIKL E DGR+TD+NG GP VD AA+ AL Sbjct: 61 LGGDNLQPFEALIDGRGFTDCFVRVPGETRSNIKLVEADGRVTDINGQGPEVDEAARSAL 120 Query: 121 LARLEQIAPGHDVVVVAGSLPRGVSPQWLQALIARMKALGLNVALDTSGEALRVALAAGP 180 L RLEQIAPGHD VVVAGSLPRG+S W + L+ R+KA GL V LD+SGEALRV L + P Sbjct: 121 LHRLEQIAPGHDAVVVAGSLPRGISADWFRQLLERLKAQGLKVVLDSSGEALRVGLQSAP 180 Query: 181 WLIKPNTEELADALGCEVVSETAQAQAAQRLHAQGIEHVVISHGADGVNWFSVGAALHAS 240 WL+KPNTEEL + LG V + T Q AA+RL G+EHVV+S G GV+WFS AL A Sbjct: 181 WLVKPNTEELGEVLGLAVDNLTQQRAAAKRLLDSGVEHVVVSAGEQGVSWFSRDLALQAR 240 Query: 241 PPKVSVASTVGAGDSLLAGMLHGLLSADTPEQTLRTATAIAAMAVTQIGFGIHDTALLAS 300 PPKV VASTVGAGDSL+AGM+HGLL A+ P QTL ATAIAA AVTQ+GFGIHD LA Sbjct: 241 PPKVRVASTVGAGDSLVAGMVHGLLLAEAPAQTLTRATAIAAQAVTQVGFGIHDREHLAQ 300 Query: 301 LEQGVRVRPLTEQ 313 LE V+ LTEQ Sbjct: 301 LEAAVQ---LTEQ 310 Lambda K H 0.317 0.132 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 315 Length adjustment: 27 Effective length of query: 286 Effective length of database: 288 Effective search space: 82368 Effective search space used: 82368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate PP_0794 PP_0794 (1-phosphofructokinase monomer)
to HMM TIGR03828 (pfkB: 1-phosphofructokinase (EC 2.7.1.56))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03828.hmm # target sequence database: /tmp/gapView.32450.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03828 [M=305] Accession: TIGR03828 Description: pfkB: 1-phosphofructokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-108 346.1 0.3 8.4e-108 345.9 0.3 1.0 1 lcl|FitnessBrowser__Putida:PP_0794 PP_0794 1-phosphofructokinase mo Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_0794 PP_0794 1-phosphofructokinase monomer # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 345.9 0.3 8.4e-108 8.4e-108 1 304 [. 4 307 .. 4 308 .. 0.99 Alignments for each domain: == domain 1 score: 345.9 bits; conditional E-value: 8.4e-108 TIGR03828 1 IlTvTlNpaiDktieleelelgevnrveserldagGKGinVarvLkklgvevvalgflGgftgeeiealleeegi 75 IlT+TlNpa+D ti l++l++g+vnr ++++ +a+GKG+nVa+vL++lg++v++ gflGg++ +++eal++ +g+ lcl|FitnessBrowser__Putida:PP_0794 4 ILTLTLNPALDITIGLDTLRPGQVNRSQAQHSHAAGKGLNVAQVLADLGHSVTVGGFLGGDNLQPFEALIDGRGF 78 89************************************************************************* PP TIGR03828 76 ktdfvevkgetRinvkikessgeetklnepGpeiseeeleallekleeqlkegdvlvlaGSlPrgvpedlyaeli 150 ++ fv+v+getR+n+k++e +g++t++n++Gpe++e++ all++le+ ++ +d +v+aGSlPrg+++d++ +l+ lcl|FitnessBrowser__Putida:PP_0794 79 TDCFVRVPGETRSNIKLVEADGRVTDINGQGPEVDEAARSALLHRLEQIAPGHDAVVVAGSLPRGISADWFRQLL 153 ***********************************************999************************* PP TIGR03828 151 kllrekgakvilDtsgeaLlkvlkakplliKPNkeEleellgrelkteeevieaarkllekgvenvlislGadGa 225 ++l+++g+kv+lD+sgeaL+ +l++ p+l+KPN+eEl e+lg ++++ ++ aa++ll++gve+v++s G++G+ lcl|FitnessBrowser__Putida:PP_0794 154 ERLKAQGLKVVLDSSGEALRVGLQSAPWLVKPNTEELGEVLGLAVDNLTQQRAAAKRLLDSGVEHVVVSAGEQGV 228 *************************************************************************** PP TIGR03828 226 llvtkegalfakapkievkstvGAGDsmvAgfllalekglsleealrlavAvgaaaassegtelpdledieelle 300 +++++ al+a++pk++v+stvGAGDs+vAg++++l + ++++l+ a+A++a+a+++ g+++ d+e++++l++ lcl|FitnessBrowser__Putida:PP_0794 229 SWFSRDLALQARPPKVRVASTVGAGDSLVAGMVHGLLLAEAPAQTLTRATAIAAQAVTQVGFGIHDREHLAQLEA 303 *************************************************************************99 PP TIGR03828 301 evki 304 v++ lcl|FitnessBrowser__Putida:PP_0794 304 AVQL 307 9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (305 nodes) Target sequences: 1 (315 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.54 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory