GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fruI in Pseudomonas putida KT2440

Align Phosphoenolpyruvate--protein phosphotransferase (EC 2.7.3.9) (characterized)
to candidate PP_5145 PP_5145 phosphoenolpyruvate-dependent regulator (with NPR and NTR proteins)

Query= reanno::WCS417:GFF780
         (952 letters)



>lcl|FitnessBrowser__Putida:PP_5145 PP_5145
           phosphoenolpyruvate-dependent regulator (with NPR and
           NTR proteins)
          Length = 759

 Score =  328 bits (842), Expect = 6e-94
 Identities = 201/561 (35%), Positives = 320/561 (57%), Gaps = 16/561 (2%)

Query: 404 IAAAPGIAIGPAHIQV----LQVFDYPLRGESCAIERERLHSALADVRRDIQGLIERSQS 459
           +  +PG A+G A + +    L+V       +  A E +   +AL  VR D++ L  +  +
Sbjct: 181 VPGSPGAAVGRAVVMLPPADLEVVPDKTVDDIDA-ELKLFQNALEGVRDDMRKLSAKLAT 239

Query: 460 KAI---REIFVTHQEMLDDPELTDEVDTRLKQGESAEAAWMSVIEAAAKQQESLQDALLA 516
           +     R +F  +  ML+D  L  EV   +K G+ A+ A   V+     + E + D  L 
Sbjct: 240 QLRPEERALFDVYLMMLEDAALGGEVTEVIKTGQWAQGALRQVVGEHVNRFELMDDDYLR 299

Query: 517 ERAADLRDIGRRVLAQLCGVET-SQEPSEPYILVMDEVGPSDVARLDPARVAGILTARGG 575
           ERA+D++D+GRR+LA L    + S   ++  ILV +E+ P+ +  +   ++ G+++  G 
Sbjct: 300 ERASDVKDLGRRLLAYLQEARSQSLVYADNTILVSEELTPAMLGEVPEGKLVGLVSVLGS 359

Query: 576 ATAHSAIVARALGIPALVGAGPAVLLLAAGTPLLLDGQRGRLHVDADAATLQRATVERDT 635
             +H AI+ARA+GIP ++G          G  L++DG +G +  +      ++ +   + 
Sbjct: 360 GNSHVAILARAMGIPTVMGLVDLPYSKVDGIELIVDGYKGEVFTNPSEVLRKQYSEVVEE 419

Query: 636 REQRLQAASAQRHEPALTRDGHAVEVFANIGESAGVASAVEQGAEGIGLLRTELIFMAHP 695
             Q  Q   A R  P +T DGH + ++ N G  A VA A ++GAEG+GL RTE+ FM + 
Sbjct: 420 ERQLAQGLDALRELPCVTPDGHRMPLWVNTGLLADVARAQQRGAEGVGLYRTEVPFMINQ 479

Query: 696 QAPDEATQEAEYRRVLDGLAGRPLVVRTLDVGGDKPLPYWPIAEEENPFLGVRGIRLTLQ 755
           + P E  Q A YR  L      P+ +RTLD+GGDK L Y+PI +EENPFLG RGIR+TL 
Sbjct: 480 RFPSEKEQLAIYREQLAAFHPLPVTMRTLDIGGDKALSYFPI-KEENPFLGWRGIRVTLD 538

Query: 756 RPQIMEAQLRALLRSADN-RPLRIMFPMVGSVDEWRAARDMTERLRLEI-----PVADLQ 809
            P+I   Q RA+L++++    LRI+ PM+  + E   A  +  R   E+      V    
Sbjct: 539 HPEIFLVQTRAMLKASEGLNNLRILLPMISGIHELEEALHLIHRAWGEVRDEGTDVPMPP 598

Query: 810 LGIMIEVPSAALLAPVLAKEVDFFSVGTNDLTQYTLAIDRGHPTLSAQADGLHPAVLQLI 869
           +G+M+E+P+A      LA++VDF SVG+NDLTQY LA+DR +P ++   D LHPAVLQ +
Sbjct: 599 VGVMVEIPAAVYQTKELARQVDFLSVGSNDLTQYLLAVDRNNPRVADLYDYLHPAVLQAL 658

Query: 870 DITVRAAHAHGKWVGVCGELAADPLAVPVLVGLGVDELSVSARSIPEVKARVREFSLSEA 929
           +  VR AH  GK V +CGE+A DP A  +L+ +G D LS++A ++P+VK  +R+ ++ +A
Sbjct: 659 NTVVRDAHGEGKPVSICGEMAGDPAAAVLLMAMGFDSLSMNATNLPKVKWMLRQINMGKA 718

Query: 930 QGLAQKALAVGSPAEVRALVE 950
           + L  +AL+  +P  + + ++
Sbjct: 719 KELLAEALSHDNPQVIHSSLQ 739


Lambda     K      H
   0.318    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1442
Number of extensions: 77
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 952
Length of database: 759
Length adjustment: 42
Effective length of query: 910
Effective length of database: 717
Effective search space:   652470
Effective search space used:   652470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory