Align Maltose transport system permease protein malG aka TT_C1629, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)
to candidate PP_2263 PP_2263 Sugar ABC transporter, permease protein
Query= TCDB::Q72H66 (280 letters) >FitnessBrowser__Putida:PP_2263 Length = 266 Score = 146 bits (368), Expect = 5e-40 Identities = 91/276 (32%), Positives = 138/276 (50%), Gaps = 13/276 (4%) Query: 3 RASRLLGRLFFYLLVVFVVVYSVFPFYWAVISSFKPSDALFSPDPSFLPVPFTLEHYENV 62 R S L FF+LLV P YW + SFK S+A + P FTL++Y + Sbjct: 4 RKSMALLLYFFFLLV---------PIYWLLNMSFK-SNAEILGGLTLWPQAFTLDNYRVI 53 Query: 63 FLQANFGRNLLNSLIVAGGATLLSLVLGVLAAYALGRLPFPPKNAVMYIVLSMTMFPQIA 122 F A++ +NSL TL+SL++ + AAYA R F + + +L+ M P Sbjct: 54 FTDASWYSGYINSLYYVCLNTLISLLVALPAAYAFSRYRFLGDRHLFFWLLTNRMAPPAV 113 Query: 123 VLGGLFLLLRQTGLFNTHLGLILTYLLFTLPFTVWVLVGYFRGLPRELEEAAYVDGATPL 182 L F L GLF+TH+ + L + LF +P VW+L G+ G+PRE++E AY+DG + Sbjct: 114 FLLPFFQLYSSIGLFDTHIAVALAHCLFNVPLAVWILEGFMSGVPREIDETAYIDGYSFP 173 Query: 183 QTLLKVMLPLTGPGLVTTGLLAFIAAWNEYLFALTFTVGDSVKTVPPAIASFGGATPFEI 242 + +K+ +PL G G+ T F+ +W E L A T T SV P A + I Sbjct: 174 RFFVKIFIPLIGSGIGVTAFFCFMFSWVELLLARTLT---SVNAKPIAAVMTRTVSASGI 230 Query: 243 PWGSIMAASVVVTVPLVVLVLVFQQRIVAGLTAGAV 278 WG + AA V+ +P ++++ + + G G V Sbjct: 231 DWGVLAAAGVLTILPGMLVIWFVRNHVAKGFALGRV 266 Lambda K H 0.329 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 131 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 266 Length adjustment: 25 Effective length of query: 255 Effective length of database: 241 Effective search space: 61455 Effective search space used: 61455 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory