Align ABC transporter (characterized, see rationale)
to candidate PP_5168 PP_5168 sulfate/thiosulfate import ATP-binding protein
Query= uniprot:A0A166QFW2 (381 letters) >FitnessBrowser__Putida:PP_5168 Length = 329 Score = 231 bits (588), Expect = 3e-65 Identities = 119/260 (45%), Positives = 178/260 (68%), Gaps = 7/260 (2%) Query: 2 IKLKLDNVNKQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLL 61 + +++ NV+K+ + L ++L+I +GE V +GPSGCGK+TLLR+IAGL++ G+++ Sbjct: 1 MSIEVRNVSKRFNSFQALNAINLDINSGELVALLGPSGCGKTTLLRIIAGLETPDQGNIV 60 Query: 62 IDGRRVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLA----KTDKTSLRERVLKT 117 G V+ + R+R VG VFQ YAL+ HMSV+DN++FGL++ + ++ + E+V + Sbjct: 61 FHGEDVSGHDVRDRNVGFVFQHYALFRHMSVFDNVAFGLRMKPKGERPSESKIAEKVHEL 120 Query: 118 AQILQLDKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIA 177 ++QLD L R P++LSGGQRQR+A+ RA+A EP +LL DEP LDA +R ++R +A Sbjct: 121 LNMVQLDWLSDRYPEQLSGGQRQRIALARALAVEPKVLLLDEPFGALDAKVRKELRRWLA 180 Query: 178 RLHDRLGSTMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGSP 237 RLH+ + T ++VTHDQ EAM +AD+IVV+N G +EQ+GSP E+Y++PA+ FV FLG Sbjct: 181 RLHEDINLTSVFVTHDQEEAMEVADRIVVMNKGVIEQIGSPGEVYDQPANDFVYHFLGDS 240 Query: 238 RMNFLSAR---LQTPGETSL 254 LS L P E SL Sbjct: 241 NRLALSEGHHVLFRPHEVSL 260 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 329 Length adjustment: 29 Effective length of query: 352 Effective length of database: 300 Effective search space: 105600 Effective search space used: 105600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory