Align Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein; LIVAT-BP; Leu/Ile/Val/Thr/Ala-binding protein (characterized)
to candidate PP_4867 PP_4867 branched-chain amino acid ABC transporter, periplasmic amino acid-binding protein (braC-like)
Query= SwissProt::P21175 (373 letters) >FitnessBrowser__Putida:PP_4867 Length = 378 Score = 285 bits (728), Expect = 2e-81 Identities = 154/361 (42%), Positives = 225/361 (62%), Gaps = 10/361 (2%) Query: 12 FAAMAIA---GFASYSMAADTIKIALAGPVTGPVAQYGDMQRAGALMAIEQINKAGGVNG 68 F A+A+A G +SY A +KI +AGP+TG A +G+ GA A ++IN AGGVNG Sbjct: 10 FLALAVATALGVSSYVQA--DVKIGVAGPMTGANAAFGEQYMKGAQAAADKINAAGGVNG 67 Query: 69 AQLEGVIYDDACDPKQAVAVANKVVN-DGVKFVVGHVCSSSTQPATDIYEDEGVLMITPS 127 ++ V DDAC+PKQAVAVAN++V+ D V VVGH CSS+T PA+++Y++ GV+ ITP Sbjct: 68 EKIVLVKGDDACEPKQAVAVANRLVDQDKVIGVVGHFCSSNTIPASEVYDEAGVIAITPG 127 Query: 128 ATAPEITSRGYKLIFRTIGLDNMQGPVAGKFIAERYKDKTIAVLHDKQQYGEGIATEVKK 187 +T P++T RG +FR G D+ QG VAG +I + K K +AVLHDK YG+G+A K Sbjct: 128 STNPQVTERGLSAMFRMCGRDDQQGIVAGDYIVDVLKGKKVAVLHDKDTYGQGLADATKA 187 Query: 188 TVEDAGIKVAVFEGLNAGDKDFNALISKLKKAGVQFVYFGGYHPEMGLLLRQAKQAGL-D 246 +E G+K ++EGL G+KDF+A+++K++ G VYFGG HPE G L+RQ ++ GL D Sbjct: 188 QLEKRGVKPVLYEGLTRGEKDFSAVVTKIRSTGADVVYFGGLHPEAGPLVRQLREQGLKD 247 Query: 247 ARFMGPEGVGNSEITAIAGDAS--EGMLATLPRAFEQDPKNKALIDAFKAKNQDPSGIFV 304 +FM +G+ E+ + AG A +G+ T P +KA+++ F+ +P G + Sbjct: 248 VKFMSDDGIVTDELVSTAGGAQYVDGVYMTFGADPRLLPDSKAVVEEFRKAGTEPEG-YT 306 Query: 305 LPAYSAVTVIAKGIEKAGEADPEKVAEALRANTFETPTGNLGFDEKGDLKNFDFTVYEWH 364 L AY+++ +A A E A+ L+AN +T G +D KGDL D+ VY+W Sbjct: 307 LYAYASLQALAAAFNGAKSNKGEDAAKWLKANPVQTVMGEKKWDSKGDLTVSDYVVYQWD 366 Query: 365 K 365 K Sbjct: 367 K 367 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 378 Length adjustment: 30 Effective length of query: 343 Effective length of database: 348 Effective search space: 119364 Effective search space used: 119364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory