Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate PP_2767 PP_2767 putative Branched-chain amino acid ABC transporter, ATP-binding protein
Query= TCDB::P21629 (255 letters) >FitnessBrowser__Putida:PP_2767 Length = 277 Score = 200 bits (508), Expect = 3e-56 Identities = 95/250 (38%), Positives = 157/250 (62%) Query: 4 PILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIR 63 P+LE+ G+++ F G+ A++ + V E ++ ++IGPNGAGK+++ N + G Y+ G IR Sbjct: 5 PLLELEGISLSFKGVKAISDIGFSVAEGEICALIGPNGAGKSSLLNIINGVYRAQQGRIR 64 Query: 64 LDGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAF 123 G++ + + H AR G+ RTFQN+ LFK M+ ++N+L ++ +++L + Sbjct: 65 FAGQQRRVMHPHAAARDGIARTFQNIALFKGMSVLDNVLTGRNLKRRSSWLEQALRIGRA 124 Query: 124 RRSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAG 183 + A +E + + + + GTL YG Q+R+E+AR + PR+L+LDEP AG Sbjct: 125 PGEDDRQRAAAERVIEFLRIQPWRDEIVGTLPYGLQKRIELARALAAEPRLLLLDEPMAG 184 Query: 184 LNPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQIRD 243 +N +E ++ I ++ E +TV+LIEHD+ +VM IS H+VV++ G + DG+PEQ+R Sbjct: 185 MNAEEKREMSRFIVEINREFGMTVVLIEHDIGVVMGISHHVVVLDYGRKIGDGSPEQVRR 244 Query: 244 NPDVIKAYLG 253 NPDVI AYLG Sbjct: 245 NPDVIAAYLG 254 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 277 Length adjustment: 25 Effective length of query: 230 Effective length of database: 252 Effective search space: 57960 Effective search space used: 57960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory