Align Hydroxyacylglutathione hydrolase GloC; EC 3.1.2.6; Accessory type II glyoxalase; Glyoxalase II 2; GlxII-2 (uncharacterized)
to candidate PP_0052 PP_0052 beta-lactamase domain protein, putative hydrolase
Query= curated2:Q57544 (212 letters) >FitnessBrowser__Putida:PP_0052 Length = 294 Score = 69.3 bits (168), Expect = 7e-17 Identities = 61/169 (36%), Positives = 81/169 (47%), Gaps = 19/169 (11%) Query: 34 AERLIQRIEELDLNLKVLLLTHGHLDHVGAAMQLKQH------FGVEIWGSNEKDKFLFE 87 A+RLI+R+ EL+ +++ +L TH H DH+ AA LK+ G I + LF Sbjct: 53 ADRLIERVNELNASVRWVLETHVHADHLSAAAYLKEKLGGHTAIGAHITQVQKVFGALFN 112 Query: 88 SLPEQAQRFGLPNIDAFLPDRWFNQEGEILKLDGFNFEILHLPGHTPGHIGF-IEHEKKV 146 + P A R G D L D +EG ++ LH PGHTP + F IE ++ Sbjct: 113 AEPGFA-RDG-SQFDVLLED----EEG--FRIGNLQARALHTPGHTPACMSFMIEDAGEI 164 Query: 147 A-FTGDVLFQG--GIGRTDFPRGDYETLISSIRTKLLPLNDDIIIIAGH 192 A F GD LF G R DFP D TL SIR +LL D + H Sbjct: 165 AVFVGDTLFMPDYGTARCDFPGADARTLYRSIR-RLLAFPDQTRLFMCH 212 Lambda K H 0.321 0.142 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 294 Length adjustment: 24 Effective length of query: 188 Effective length of database: 270 Effective search space: 50760 Effective search space used: 50760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory