Align hydroxyacylglutathione hydrolase; EC 3.1.2.6 (characterized)
to candidate PP_4144 PP_4144 Hydroxyacylglutathione hydrolase
Query= CharProtDB::CH_024825 (251 letters) >FitnessBrowser__Putida:PP_4144 Length = 259 Score = 211 bits (538), Expect = 9e-60 Identities = 122/269 (45%), Positives = 159/269 (59%), Gaps = 29/269 (10%) Query: 1 MNLNSIPAFDDNYIWVLNDEAGR-CLIVDPGDAEPVLNAIAAN-NWQPEAIFLTHHHHDH 58 + + ++PAF DNYIW+L D A R C +VDPGDA PV +AAN W I +THHH+DH Sbjct: 2 IQIEALPAFSDNYIWLLQDTAKRRCAVVDPGDAGPVERWLAANPEWVLSDILVTHHHNDH 61 Query: 59 VGGVKELVEKFPQIVVYGPQETQDKGTTQVVKDGETAFVLGHEFSVIATPGHTLGHICYF 118 VGGV+ L + V GP + G + +G+ VLG F V+A PGHTLGHI +F Sbjct: 62 VGGVERL-RQLTGARVCGPANERIPGRDLALDEGDRVDVLGVTFQVMAVPGHTLGHIAFF 120 Query: 119 SK----PYLFCGDTLFSGGCGRLFEGTASQMYQSLKKLSALPDDTLVCCAHEYTLSNMKF 174 S P LF GDTLF+ GCGR+FEGT QM +L +L+ALP+ T V CAHEYTLSN++F Sbjct: 121 SDQPATPILFSGDTLFAAGCGRMFEGTPEQMQPALARLAALPEQTQVYCAHEYTLSNLRF 180 Query: 175 ALSILPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDIDLINVINEETLL 234 A ++ P + + + V LRA+N+I+LP + ER N FLRT ETL+ Sbjct: 181 AKAVEPTNPHVQQRFEDVTRLRAENRISLPSTIGLERLTNPFLRT----------AETLV 230 Query: 235 QQPEER------------FAWLRSKKDRF 251 +Q + FA LRS KD F Sbjct: 231 KQKADEWKGHSNNSHVAVFAALRSWKDTF 259 Lambda K H 0.321 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 259 Length adjustment: 24 Effective length of query: 227 Effective length of database: 235 Effective search space: 53345 Effective search space used: 53345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate PP_4144 PP_4144 (Hydroxyacylglutathione hydrolase)
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.24500.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-105 337.7 0.0 2.2e-105 337.5 0.0 1.0 1 lcl|FitnessBrowser__Putida:PP_4144 PP_4144 Hydroxyacylglutathione h Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_4144 PP_4144 Hydroxyacylglutathione hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 337.5 0.0 2.2e-105 2.2e-105 1 248 [] 4 259 .] 4 259 .] 0.98 Alignments for each domain: == domain 1 score: 337.5 bits; conditional E-value: 2.2e-105 TIGR03413 1 iiaipalsdNyiwllkdeks.eavvvDpgeaepvlealeek.glkleaillTHhHaDHvggvaellekfpvkvvg 73 i+a+pa+sdNyiwll+d+++ +++vvDpg+a pv ++l+++ ++ l++il+THhH+DHvggv++l++ ++++v+g lcl|FitnessBrowser__Putida:PP_4144 4 IEALPAFSDNYIWLLQDTAKrRCAVVDPGDAGPVERWLAANpEWVLSDILVTHHHNDHVGGVERLRQLTGARVCG 78 6789***************99*****************98769******************************** PP TIGR03413 74 paeeripgltkevkegdevellelevevlevpGHtlgHiayyleee..kvlFcgDtLfsaGCGrlfegtaeqmle 146 pa+eripg + +++egd+v++l+ +++v++vpGHtlgHia+++++ ++lF+gDtLf+aGCGr+fegt+eqm lcl|FitnessBrowser__Putida:PP_4144 79 PANERIPGRDLALDEGDRVDVLGVTFQVMAVPGHTLGHIAFFSDQPatPILFSGDTLFAAGCGRMFEGTPEQMQP 153 ******************************************9975679************************** PP TIGR03413 147 slqklaaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealrakgkptlPstlaeekatNpFLraeea 221 +l +laaLpe+t+vycaHEYtlsNlrFa+avep+n+++++r ++v++lra+++++lPst++ e+ tNpFLr++e+ lcl|FitnessBrowser__Putida:PP_4144 154 ALARLAALPEQTQVYCAHEYTLSNLRFAKAVEPTNPHVQQRFEDVTRLRAENRISLPSTIGLERLTNPFLRTAET 228 *************************************************************************** PP TIGR03413 222 evkaalee....ekaeevevfaelRekkdkf 248 vk++++e +++++v+vfa+lR++kd+f lcl|FitnessBrowser__Putida:PP_4144 229 LVKQKADEwkghSNNSHVAVFAALRSWKDTF 259 ******9999999999*************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (259 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.32 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory