GapMind for catabolism of small carbon sources

 

Aligments for a candidate for serP1 in Pseudomonas putida KT2440

Align Serine uptake transporter, SerP1, of 259 aas and 12 TMSs (Trip et al. 2013). L-serine is the highest affinity substrate (Km = 18 μM), but SerP1 also transports L-threonine and L-cysteine (Km values = 20 - 40 μM) (characterized)
to candidate PP_0927 PP_0927 aromatic amino acid transport protein

Query= TCDB::F2HQ25
         (459 letters)



>lcl|FitnessBrowser__Putida:PP_0927 PP_0927 aromatic amino acid
           transport protein
          Length = 453

 Score =  283 bits (725), Expect = 6e-81
 Identities = 160/458 (34%), Positives = 255/458 (55%), Gaps = 24/458 (5%)

Query: 1   MENLQEKHEAQRGLQNRHIQLIAIAGTIGTGLFLGAGKTIQMTGPSVIFAYILIGIAMFF 60
           M++       QRGL+NRHIQLIA+ G IGTGLFLG  +TIQ+ GPSV+  Y + G+  F 
Sbjct: 1   MQDQSTPERLQRGLKNRHIQLIALGGAIGTGLFLGIAQTIQLAGPSVLLGYAIAGLMAFL 60

Query: 61  FLRTIGEMLYNDPSQHSFLNFVTKYSGVRTGYFTQWSYWLVIVFVCISELTAIGTYIQFW 120
            +R +GEM+  +P   SF +F  +Y     G+ + W+YW+V V V ++ELTA+G Y+Q+W
Sbjct: 61  IMRQLGEMVVEEPVAGSFSHFAHQYWSEFAGFVSGWNYWVVYVLVGMAELTAVGIYVQYW 120

Query: 121 LPQVPLWLIEIVMLALLFGLNTLNSRFFGETEFWFAMIKVAAIIGMIVTAIILVAGNFHY 180
            P  P W    +   ++  +N    + +GE EFWFA++KV AI+ MI     L+ G+ H 
Sbjct: 121 WPDFPTWATAAIFFVVINLINLTQVKVYGEMEFWFALVKVVAIVSMIGFGAWLL-GSGHG 179

Query: 181 STVLSGKTVHDSASLSNIFDGFQLFPHGAWNFVGALQMVMFAFTSMEFIGMTAAETVNPK 240
                       AS++N++     FP+G    V AL ++MF+F  +E +G+TAAE  NP+
Sbjct: 180 G---------PDASVANLWQYGGFFPNGVTGLVMALAVIMFSFGGLELVGITAAEADNPR 230

Query: 241 KSLPKAINQIPVRILLFYVGALLAIMAIFNWHYIPADKSPFVMVFQLIGIKWAAALINFV 300
           +S+PKA NQ+  RIL+FY+GAL  +++++ W  +    SPFVM+F  +     A ++N V
Sbjct: 231 ESIPKATNQVVYRILIFYIGALAVLLSLYPWQKVVQGGSPFVMIFHELDSDLVATILNIV 290

Query: 301 VLTSAASALNSSLFSATRNMYSLAQQHDKGRLTPFTKLSKAGIPINALYM-ATALSLLAP 359
           VLT+A S  NS +++ +R ++ LA Q D  R     K+S++G+P+ AL + A A  L   
Sbjct: 291 VLTAALSVYNSCVYANSRMLFGLASQGDAPR--QLLKVSRSGVPLTALAVSAFATGLCVL 348

Query: 360 VLTLIPQIKNAFDFAASCTTNLFLVVYFITLYTYWQYRKSE-------DYNPKGFLTPKP 412
           +  L+P    AF    +   +  ++ +     T+ ++RK++        Y   G      
Sbjct: 349 INYLMP--GGAFGLLMALAVSALVINWASISITHLKFRKAKLAAGITPFYKSLGHPLTN- 405

Query: 413 QITVPFIVAIFAIVFASLFFNADT-FYPALGAIVWTIF 449
            + + FIV I  +++ +          PA  A++W  F
Sbjct: 406 YLCLAFIVLILVVMYLTPPIRISVMLIPAWIAVLWVAF 443


Lambda     K      H
   0.329    0.141    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 554
Number of extensions: 32
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 459
Length of database: 453
Length adjustment: 33
Effective length of query: 426
Effective length of database: 420
Effective search space:   178920
Effective search space used:   178920
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory