Align L-threonine 3-dehydrogenase (EC 1.1.1.103) (characterized)
to candidate PP_0328 PP_0328 formaldehyde dehydrogenase
Query= BRENDA::P07913 (341 letters) >FitnessBrowser__Putida:PP_0328 Length = 399 Score = 104 bits (259), Expect = 4e-27 Identities = 84/270 (31%), Positives = 137/270 (50%), Gaps = 38/270 (14%) Query: 28 LLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMVVGHEYVGEVVGIGQEVKGFKIGDRVSG 87 +++K+ T ICG+D H+ + T V +V+GHE GE+V G++V+ +IGD VS Sbjct: 37 VILKVVSTNICGSDQHMVR----GRTTAQVGLVLGHEITGEIVEKGRDVERMQIGDLVSV 92 Query: 88 EGHITCGHCRNCRGGRTHLCRNT-----------IGVGVNRPGCFAEYLVIP--AFNAFK 134 ++ CG CR+C+ T +C + +G + G AEY+++P FN K Sbjct: 93 PFNVACGRCRSCKEMHTGVCLTVNPARAGGAYGYVDMG-DWTGGQAEYVLVPYADFNLLK 151 Query: 135 IPDNIS-----DDLAAIFDPFGNAVHTALSFDL-VGEDVLVSGAGPIGIMAAAVAKHVGA 188 +P+ DL + D H A++ + G V V+GAGP+G+ AAA A+ +GA Sbjct: 152 LPERDKAMEKIRDLTCLSDILPTGYHGAVTAGVGPGSTVYVAGAGPVGLAAAASARLLGA 211 Query: 189 RNVVITDVNEYRLELARKMGITRAVNVAK-----ENLNDVMAELGMTEGFD-VGLEMSG- 241 V++ D+N RL A+ G V+++K E + D++ E + D VG E G Sbjct: 212 ACVIVGDLNPARLAHAKSQGF-EVVDLSKDTPLHEQIVDILGEPEVDCAVDAVGFEARGH 270 Query: 242 -----APPAFRTMLDTMNHGGRIA-MLGIP 265 A T+L+++ R+A +GIP Sbjct: 271 GHEGAKHEAPATVLNSLMQVTRVAGNIGIP 300 Lambda K H 0.322 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 399 Length adjustment: 30 Effective length of query: 311 Effective length of database: 369 Effective search space: 114759 Effective search space used: 114759 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory