Align Glyoxal reductase; GR; Methylglyoxal reductase; EC 1.1.1.-; EC 1.1.1.283 (characterized)
to candidate PP_2368 PP_2368 2,5-diketo-D-gluconate reductase
Query= SwissProt::O32210 (276 letters) >FitnessBrowser__Putida:PP_2368 Length = 267 Score = 171 bits (434), Expect = 1e-47 Identities = 102/258 (39%), Positives = 143/258 (55%), Gaps = 9/258 (3%) Query: 15 VEMPWFGLGVFKVENGNEATESVKAAIKNGYRSIDTAAIYKNEEGVGIGIKESGVAREEL 74 + +P FGLG F++ G +SVK+A+ GYR IDTA IYKNE VG I ESGV R EL Sbjct: 1 MSVPSFGLGTFRL-TGQTVIDSVKSALAVGYRVIDTAQIYKNEAEVGQAIAESGVPRSEL 59 Query: 75 FITSKVWNEDQGYETTLAAFEKSLERLQLDYLDLYLIHWPGKD---KYKDTWRALEKLYK 131 FIT+K+W ++ + + + SL++L+ DY+DL LIHWP + + +AL + Sbjct: 60 FITTKIWVDNYAADKLIPSLRDSLQKLRTDYVDLLLIHWPAPGNGVELPEYMKALADAKQ 119 Query: 132 DGKIRAIGVSNFQVHHLEE---LLKDAEIKPMVNQVEFHPRLTQKELRDYCKGQGIQLEA 188 G R IGVSNF + + ++ EI NQ+E P L +L + K QGI + + Sbjct: 120 QGLARQIGVSNFNIELTRQAIAVVGKGEI--ATNQIELSPYLQNSKLTAFLKEQGITVTS 177 Query: 189 WSPLMQGQLLDNEVLTQIAEKHNKSVAQVILRWDLQHGVVTIPKSIKEHRIIENADIFDF 248 + L G++L + VL QIA KH +VAQV L W LQ G IP S K + N Sbjct: 178 YMTLAYGKVLKDPVLAQIAAKHKATVAQVALAWALQLGYAVIPSSTKRENLASNLLARGL 237 Query: 249 ELSQEDMDKIDALNKDER 266 L +DM +I L ++ R Sbjct: 238 TLDTDDMARIAKLERNGR 255 Lambda K H 0.316 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 276 Length of database: 267 Length adjustment: 25 Effective length of query: 251 Effective length of database: 242 Effective search space: 60742 Effective search space used: 60742 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory