Align electron transfer component of the anthranilate 1,2-dioxygenase system (EC 1.14.12.1) (characterized)
to candidate PP_1163 PP_1163 Oxidoreductase, FAD-binding
Query= reanno::WCS417:GFF4631 (335 letters) >FitnessBrowser__Putida:PP_1163 Length = 678 Score = 80.9 bits (198), Expect = 9e-20 Identities = 67/217 (30%), Positives = 101/217 (46%), Gaps = 21/217 (9%) Query: 134 FLPGQYARLSVPGTDSW---RSYSFANLPGNHLQFLVRLLPDGVMSNYLRERCQVGDELL 190 F PGQ+ + VP R+YS ++ P + + + G S YL ER GD L Sbjct: 359 FAPGQHLPVQVPRDGESALIRTYSLSSAPDDGF-LRISVKAQGPASRYLHERVVAGDVLN 417 Query: 191 MEAPLGAFYL-RHVTQPLVLVAGGTGLSALLGMLDQLAANGCEQPVHLYYGVRGAEDL-- 247 + P+G+F L + T+PLVL+ G G++ LL ML Q G + +HL++G R DL Sbjct: 418 VRPPMGSFTLDQQSTRPLVLIGAGVGITPLLAMLRQQLRTGQARRIHLFHGARSLADLPF 477 Query: 248 -CEAARIRAYAAKIPNLRYTEVLSAP--------SEEWSGKRGYLTEHFDLAELRDGSAD 298 E A +R A + L+ LS P E++G+ G LA L D D Sbjct: 478 QQELAALRQQAGDL--LQVHRALSQPEGHAQVGRDYEFAGRLGIEQVKATLA-LDD--YD 532 Query: 299 MYLCGPPPMVESIQQWLADQALDGVQLYYEKFTQSNI 335 YLCGP + + + L + +++ E F S + Sbjct: 533 FYLCGPGSFTQQLYEGLRGVHVPDARIHAEAFGPSTL 569 Score = 30.8 bits (68), Expect = 1e-04 Identities = 14/31 (45%), Positives = 17/31 (54%) Query: 25 LLDAALRNGIKIPLDCREGVCGTCQGRCESG 55 LL+ A G+ CR G CGTC+ R SG Sbjct: 610 LLELAEARGLAPEFSCRGGSCGTCKTRLVSG 640 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 565 Number of extensions: 35 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 335 Length of database: 678 Length adjustment: 33 Effective length of query: 302 Effective length of database: 645 Effective search space: 194790 Effective search space used: 194790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory