GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aroP in Pseudomonas putida KT2440

Align Aromatic amino acid permease, AroP (characterized)
to candidate PP_0284 PP_0284 gamma-aminobutyrate permease

Query= TCDB::Q46065
         (463 letters)



>lcl|FitnessBrowser__Putida:PP_0284 PP_0284 gamma-aminobutyrate
           permease
          Length = 461

 Score =  354 bits (909), Expect = e-102
 Identities = 179/435 (41%), Positives = 274/435 (62%), Gaps = 4/435 (0%)

Query: 4   SNEGLGTGLRTRHLTMMGLGSAIGAGLFLGTGVGIRAAGPAVLLAYIIAGAIVVLVMQML 63
           ++  L  GL+ RH+TM+ +   IGAGLF+G+G  I AAGPAVLLAY  AG +VVLVM+ML
Sbjct: 5   NSNDLAQGLKQRHVTMLSIAGVIGAGLFVGSGHAIAAAGPAVLLAYAAAGTLVVLVMRML 64

Query: 64  GEMAAARPASGSFSRYGEDAFGHWAGFSLGWLYWFMLIMVMGAEMTGAAAIMGAWF-GVE 122
           GEMA A P +GSFS Y + A G WAGF++GWLYW+  ++V+  E   AAAI+ AWF  V+
Sbjct: 65  GEMAVASPDTGSFSTYADRAIGRWAGFTIGWLYWWFWVLVIPLEANAAAAILHAWFPAVD 124

Query: 123 PWIPSLVCVVFFAVVNLVAVRGFGEFEYWFAFIKVAVIIAFLIIGIALIFGWLPGSTFVG 182
            W  SL+  +   + NL +V+ +GEFE+WFA +KV  II F+ +G A +FG++P S   G
Sbjct: 125 LWAFSLIITLALTLTNLCSVKNYGEFEFWFALLKVLAIIGFIAVGCAALFGFVPSSQVSG 184

Query: 183 TSNFIGDHGFMPNGISGVAAGLLAVAFAFGGIEIVTIAAAESDKPREAISLAVRAVIWRI 242
           TS+     GFMPNG+  V A +L   F+F G EIVTIAAAES  P + IS A  +VIWRI
Sbjct: 185 TSHLFDTQGFMPNGLGAVLAAMLTTMFSFMGTEIVTIAAAESKDPGKQISRATNSVIWRI 244

Query: 243 SVFYLGSVLVITFLMPYESINGADTAAESPFTQILAMANIPGTVGFMEAIIVLALLSAFN 302
            +FYL S+ ++  L+P+     A+T +   +  +L+   +P     ++ ++++A+ S  N
Sbjct: 245 CLFYLVSIFLVVALVPWNDPALAETGS---YQTVLSRIGVPNAKLIVDIVVLIAVTSCLN 301

Query: 303 AQIYATSRLVFSMANRQDAPRVFSKLSTSHVPTNAVLLSMFFAFVSVGLQYWNPAGLLDF 362
           + +Y +SR++FS++ R DAP +  + + +  P  AVLLS   AF+ V   +  PA + +F
Sbjct: 302 SALYTSSRMLFSLSKRGDAPAIAQRTTKAATPHVAVLLSTAAAFLCVFANFVAPAQVFEF 361

Query: 363 LLNAVGGCLIVVWAMITLSQLKLRKELQANDEISTVRMWAHPWLGILTLVLLAGLVALML 422
           LL + G   ++V+ +I +SQL++R + +A  E  T +MW  P L   T+  +  ++ +M 
Sbjct: 362 LLASSGAIALLVYLVIAVSQLRMRAQREARGEKITFKMWLFPGLTWATIAFIVAILVVMA 421

Query: 423 GDAASRSQVYSVAIV 437
                R+++ + A++
Sbjct: 422 LREDHRAEIIATALL 436


Lambda     K      H
   0.327    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 567
Number of extensions: 24
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 463
Length of database: 461
Length adjustment: 33
Effective length of query: 430
Effective length of database: 428
Effective search space:   184040
Effective search space used:   184040
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory