Align 2-amino-5-chloromuconic acid deaminase; 2-aminomuconate deaminase; EC 3.5.99.5 (characterized)
to candidate PP_0613 PP_0613 Amidase family protein
Query= SwissProt::Q38M35 (462 letters) >FitnessBrowser__Putida:PP_0613 Length = 469 Score = 157 bits (398), Expect = 5e-43 Identities = 141/456 (30%), Positives = 201/456 (44%), Gaps = 35/456 (7%) Query: 6 LSLAEHAARLRRRELTAVALIDTCAQHHARMEPRLNAYKTWDGARARSAAAAVDTLLDQG 65 L+ E RR+L+ V ++D P +NA+ DG AR+AA A + +G Sbjct: 10 LTAVELLELYHRRQLSPVEVVDDVLARIDLHNPAVNAFCHVDGEGARAAARASEQRWQRG 69 Query: 66 QDLGPLMGLPVSVKDLYGVPGLPVFAGSDEALPEA-WQAAGPLVARLQRQLGIVVGKTHT 124 Q G L G+P S+KDL G+P GS W+ P A ++ ++VGKT T Sbjct: 70 QPCGRLDGVPASIKDLTLTRGMPTRKGSRTTSGAGPWEIDAPFSAFMREAGAVLVGKTTT 129 Query: 125 VEFAFGGLGVNAHWGTPRNPWSPHEHRVPGGSSAGAGVSLVQGSALLALGTDTAGSVRVP 184 EF + G+ N +G RNPW GGSS GA + +L G+D GS+R+P Sbjct: 130 PEFGWKGVTDNPLYGITRNPWD--TRLTAGGSSGGAAAAAALNLGVLHQGSDAGGSIRIP 187 Query: 185 ASMTGQVGLKTTVG---RWPVEGIVPLSSSLDTAGVLTRTVED---LAYAFAALDTES-- 236 + TG G+K T G +WP + LS G +TRTV+D + A D Sbjct: 188 CAFTGTFGIKPTFGYVPQWPASAMTVLSH----LGPMTRTVDDSVLMLDCVARPDARDGL 243 Query: 237 QGLPAPAPVRVQ-----GLRVGVPTNHFWDDIDPSIAAAVEAAVQRLAQAGAQVVRFPLP 291 G P AP Q GLR+ N + +DP I A V AVQRLA+ GAQV P Sbjct: 244 AGAPRQAPWLSQQQDLSGLRIAYSANFGYVQVDPQIQALVAQAVQRLARLGAQVEEVD-P 302 Query: 292 HCEEAFDIFRRGGLA-ASELAAYLDQHFPHKVERLDPVVRDRVRWAEQVSSVEYLRRKAV 350 + + F A A+ LA+ L + LDP +R Q+S EY + Sbjct: 303 GFSDPLETFNTLWFAGAARLASALSD---EQKALLDPGLRWIAEQGAQISLGEYTQALEA 359 Query: 351 LQRCGAGAARLFDDVDVLLTPTVPASPPRLADIGTVETYAPANMKA--MRNTAIS---NL 405 A DVL++P +P L P + A M T +S NL Sbjct: 360 RAELIAKMNAFHQRYDVLVSPMLP-----LVAFEAGHNVPPGSGMAQWMEWTPLSYPFNL 414 Query: 406 FGWCALTMPVGLDANRMPVGLQLMGPPRAEARLIGI 441 A ++P G +PVGLQ++ A+ +++ + Sbjct: 415 TQQPAASVPCGFTREGLPVGLQVVAGRFADEQVLRV 450 Lambda K H 0.320 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 497 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 462 Length of database: 469 Length adjustment: 33 Effective length of query: 429 Effective length of database: 436 Effective search space: 187044 Effective search space used: 187044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory