GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aacS in Pseudomonas putida KT2440

Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate PP_3458 PP_3458 Butyrate--CoA ligase

Query= reanno::acidovorax_3H11:Ac3H11_3009
         (578 letters)



>lcl|FitnessBrowser__Putida:PP_3458 PP_3458 Butyrate--CoA ligase
          Length = 562

 Score =  625 bits (1611), Expect = 0.0
 Identities = 309/556 (55%), Positives = 395/556 (71%), Gaps = 7/556 (1%)

Query: 16  SHARGATDVPLIEQTIGAFFADMVARQPEREALVSVHQGRRYTYAQLQTEAHRLASALLG 75
           S+ +G  D PL+ Q IG  F   VAR P+REALV  HQ  RYT+ QL     + A AL+ 
Sbjct: 5   SYTQGTQDKPLLTQCIGDAFDATVARFPDREALVVHHQALRYTWRQLADAVDQHARALMA 64

Query: 76  MGLTPGDRVGIWSHNNAEWVLMQLATAQVGLVLVNINPAYRTAEVEYALNKVGCKLLVSM 135
           +G+ PGDR+GIW+ N AEW + Q A+A+VG +LVNINPAYR++E++YAL + GC+ ++  
Sbjct: 65  LGVQPGDRLGIWAPNCAEWCITQFASAKVGAILVNINPAYRSSELDYALGQSGCRWVICA 124

Query: 136 ARFKTSDYLGMLRELAPEWQGQQPGHLQAAKLPQLKTVVWIDDEAGQGADEPGLLRFTEL 195
             FKTSDY  ML+ L P     QPG L   + P+L+ VV +       +  PG L +  L
Sbjct: 125 DAFKTSDYHAMLQGLLPGLASSQPGALICERFPELRGVVSL-----ALSPPPGFLAWHAL 179

Query: 196 IARGNAADPR-LAQVAAGLQATDPINIQFTSGTTGFPKGATLTHRNILNNGFFIGECMKL 254
            AR        LA   A L+  DPINIQ+TSGTTGFPKGATL+H NILNNG+ +GE + L
Sbjct: 180 QARAEVVSGEALAARQAQLRCDDPINIQYTSGTTGFPKGATLSHSNILNNGYMVGESLGL 239

Query: 255 TPADRLCIPVPLYHCFGMVLGNLACFTHGATIVYPNDGFDPLTVLQTVQDERCTGLHGVP 314
           T  DRL +PVPLYHCFGMV+ NL C THG+ ++YP+D FDPL  L+ V  E+ T L+GVP
Sbjct: 240 TEHDRLVVPVPLYHCFGMVMANLGCMTHGSALIYPSDAFDPLATLRAVAQEKATALYGVP 299

Query: 315 TMFIAELDHPRFAEFNLSTLRTGIMAGSPCPTEVMKRVVEQMNLREITIAYGMTETSPVS 374
           TMFIAELDHP+  EF+LS+LRTGIMAG+ CP EVM+RV+ +M++ E+ IAYGMTETSPVS
Sbjct: 300 TMFIAELDHPQRGEFDLSSLRTGIMAGATCPIEVMRRVIGEMHMAEVQIAYGMTETSPVS 359

Query: 375 CQSSTDTPLSKRVSTVGQVQPHLEVKIVDPDTGAVVPIGQRGEFCTKGYSVMHGYWGDEA 434
            Q+     L +RV++VG+ QP LE K+VD + G  VP G+ GE CT+GYSVM GYW +  
Sbjct: 360 LQTGAADDLERRVTSVGRTQPRLESKVVDAE-GNTVPRGEIGELCTRGYSVMLGYWNNPK 418

Query: 435 KTREAIDEGGWMHTGDLATMDAEGYVNIVGRIKDMVIRGGENIYPREIEEFLYRHPQVQD 494
            T E+ID  GWMHTGDLA MD +GYV IVGR KDM+IRGGENIYPRE+EEF + HP V D
Sbjct: 419 ATAESIDAEGWMHTGDLAVMDEQGYVRIVGRSKDMIIRGGENIYPRELEEFFFTHPAVAD 478

Query: 495 VQVVGVPDQKYGEELCAWIIAKPGTQPTEDDIRAFCKGQIAHYKVPRYIRFVTSFPMTVT 554
           VQV+GVP  KYGEE+ AW+   PG   +E ++R + + +IAH+KVPRY RFV  FPMTVT
Sbjct: 479 VQVIGVPCSKYGEEIVAWVRLHPGHAVSEVELREWARARIAHFKVPRYFRFVDEFPMTVT 538

Query: 555 GKIQKFKIRDEMKDQL 570
           GK+QKF++R+   ++L
Sbjct: 539 GKVQKFRMREISVEEL 554


Lambda     K      H
   0.320    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 884
Number of extensions: 32
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 578
Length of database: 562
Length adjustment: 36
Effective length of query: 542
Effective length of database: 526
Effective search space:   285092
Effective search space used:   285092
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory