GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aacS in Pseudomonas putida KT2440

Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate PP_4063 PP_4063 putative Long-chain-fatty-acid-CoA ligase

Query= reanno::acidovorax_3H11:Ac3H11_3009
         (578 letters)



>lcl|FitnessBrowser__Putida:PP_4063 PP_4063 putative
           Long-chain-fatty-acid-CoA ligase
          Length = 560

 Score =  620 bits (1599), Expect = 0.0
 Identities = 310/551 (56%), Positives = 389/551 (70%), Gaps = 9/551 (1%)

Query: 16  SHARGATDVPLIEQTIGAFFADMVARQPEREALVSVHQGRRYTYAQLQTEAHRLASALLG 75
           S+ RG  D PL+ QTIG  F   VAR  + EALVS HQG RY++ QL  +    A AL+ 
Sbjct: 5   SYTRGRQDRPLLTQTIGQAFDATVARCCDSEALVSRHQGLRYSWRQLAEQVEIYARALIA 64

Query: 76  MGLTPGDRVGIWSHNNAEWVLMQLATAQVGLVLVNINPAYRTAEVEYALNKVGCKLLVSM 135
           +G+  GDRVGIWS N A+W ++QLA+A+VG +LVNINPAYR  E+EY L + GC+ LV  
Sbjct: 65  LGVNTGDRVGIWSPNCAQWCILQLASAKVGAILVNINPAYRVGELEYVLRQSGCRWLVCA 124

Query: 136 ARFKTSDYLGMLRELAPEWQGQQPGHLQAAKLPQLKTVVWIDDEAGQGADEP-GLLRFTE 194
             FKTSDY  M++EL PE     PG L +  LP+L+ V+ +       A+ P G L +  
Sbjct: 125 EAFKTSDYHTMVQELVPELASAAPGELASECLPELRGVISL------AANPPAGFLPWHA 178

Query: 195 LIAR-GNAADPRLAQVAAGLQATDPINIQFTSGTTGFPKGATLTHRNILNNGFFIGECMK 253
              R G  +          LQ   P+NIQ+TSGTTG PKGATL+H NILNNGF +GE + 
Sbjct: 179 FAERAGQTSVEACTARQQSLQFDQPVNIQYTSGTTGAPKGATLSHYNILNNGFMVGESLG 238

Query: 254 LTPADRLCIPVPLYHCFGMVLGNLACFTHGATIVYPNDGFDPLTVLQTVQDERCTGLHGV 313
           LT  DR+ IPVPLYHCFGMV+ NL C THG+T++YPND FD    L+ V +ER T L+GV
Sbjct: 239 LTARDRMVIPVPLYHCFGMVMANLGCITHGSTMIYPNDAFDAELTLRAVAEERATILYGV 298

Query: 314 PTMFIAELDHPRFAEFNLSTLRTGIMAGSPCPTEVMKRVVEQMNLREITIAYGMTETSPV 373
           PTMFIA LDHP  A  +LSTLR+GIMAG+ CP EVM+RV++QM++ E+ IAYGMTETSPV
Sbjct: 299 PTMFIAMLDHPSRAHMDLSTLRSGIMAGATCPIEVMRRVIDQMHMAEVQIAYGMTETSPV 358

Query: 374 SCQSSTDTPLSKRVSTVGQVQPHLEVKIVDPDTGAVVPIGQRGEFCTKGYSVMHGYWGDE 433
           S Q+  D  L  RV+TVG+ QP LE K+VD D G +VP G+ GE CT+GYSVM GYW + 
Sbjct: 359 SLQTGPDDDLELRVTTVGRTQPQLENKLVDAD-GCIVPRGEIGELCTRGYSVMLGYWDNP 417

Query: 434 AKTREAIDEGGWMHTGDLATMDAEGYVNIVGRIKDMVIRGGENIYPREIEEFLYRHPQVQ 493
             T +AID  GWMH+GDLA MD +GYV IVGR KDM+IRGGENIYPRE+EEF Y HP V 
Sbjct: 418 QATADAIDPAGWMHSGDLAVMDEQGYVRIVGRNKDMIIRGGENIYPRELEEFFYTHPAVA 477

Query: 494 DVQVVGVPDQKYGEELCAWIIAKPGTQPTEDDIRAFCKGQIAHYKVPRYIRFVTSFPMTV 553
           D QV+G+P  +YGEE+ AWI   PG   T ++++ +CK +IAH+KVPRYIRFV  +PMTV
Sbjct: 478 DAQVIGIPCSRYGEEIVAWIKLHPGHSATVEELQGWCKARIAHFKVPRYIRFVDEYPMTV 537

Query: 554 TGKIQKFKIRD 564
           TGK+QKF++R+
Sbjct: 538 TGKVQKFRMRE 548


Lambda     K      H
   0.320    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 877
Number of extensions: 23
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 578
Length of database: 560
Length adjustment: 36
Effective length of query: 542
Effective length of database: 524
Effective search space:   284008
Effective search space used:   284008
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory