Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate PP_4620 PP_4620 Fumarylacetoacetase
Query= BRENDA::Q8RW90 (421 letters) >FitnessBrowser__Putida:PP_4620 Length = 430 Score = 374 bits (960), Expect = e-108 Identities = 199/416 (47%), Positives = 265/416 (63%), Gaps = 18/416 (4%) Query: 14 SHFPIQNLPYGVFKPESNSTPRPAVAIGDLVLDLSAISEAGLFDGLILKDADCFLQPNLN 73 S FP+QNLP G+F + R VAIGD +LDL A+ AGLFDG + LN Sbjct: 18 SDFPLQNLPLGIFSRPGEAR-RCGVAIGDAILDLEAVLAAGLFDGAAKAAVEATRGGALN 76 Query: 74 KFLAMGRPAWKEARSTLQRILSSNEPILRDNDVLRRKSFHQMSKVEMIVPMVIGDYTDFF 133 F AMGR A R LQ +L + ++ + + S ++ VP IGDYTDF+ Sbjct: 77 AFFAMGRNARVALRERLQVLLGEHS----EHQAALKPALLPASDCQLHVPAQIGDYTDFY 132 Query: 134 ASMHHAKNCGLMFRGPENAINPNWFRLPIAYHGRASSIVISGTDIIRPRGQGHPQGNSEP 193 + HAKN G +FR P+N + PN+ +PI YHGRAS+I SGTD+ RP+GQ P G++EP Sbjct: 133 VGIEHAKNVGKLFR-PDNPLLPNYKYVPIGYHGRASTIRPSGTDVRRPKGQTLPAGHTEP 191 Query: 194 YFGPSKKLDFELEMAAVVGPGNELGKPIDVNNAADHIFGLLLMNDWSARDIQAWEYVPLG 253 FGP +LD+ELE+ +G GN++G+ I V +AA+H+ GL L+NDWSARDIQAWEY PLG Sbjct: 192 SFGPCARLDYELELGIWIGQGNDMGQAIPVGDAAEHVAGLCLLNDWSARDIQAWEYQPLG 251 Query: 254 PFLGKSFGTTISPWIVTLDALEPFGCQAPKQ---DPPPLPYLAEKE---SVNYDISLEVQ 307 PFL KSF TTISPW+VT +ALEPF C P + DP PL YL +K S +DI LEV Sbjct: 252 PFLSKSFITTISPWVVTAEALEPFRCAQPARPEGDPQPLSYLLDKRDQASGAFDIELEVL 311 Query: 308 LKPSGRDDSCV----ITKSNFQNLYWTITQQLAHHTVNGCNLRPGDLLGTGTISGPEPDS 363 L + + +T SN +++YWT+ Q +AHH+VNGC L+PGDL G+GT+SG P S Sbjct: 312 LLTERMREQGIAPHRLTLSNTRSMYWTVAQLVAHHSVNGCQLQPGDLFGSGTLSGATPGS 371 Query: 364 YGCLLELTWNGQKPLSL-NGTTQTFLEDGDQVTFSGVCKGDGY-NVGFGTCTGKIV 417 +G LLE+T G+ P+ L +G + FLEDGD++ C DG ++GFG C G ++ Sbjct: 372 FGSLLEITEGGKLPVELASGEVRKFLEDGDEIILRARCTRDGVASIGFGECRGTVI 427 Lambda K H 0.319 0.139 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 584 Number of extensions: 34 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 430 Length adjustment: 32 Effective length of query: 389 Effective length of database: 398 Effective search space: 154822 Effective search space used: 154822 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate PP_4620 PP_4620 (Fumarylacetoacetase)
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.24069.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-196 639.6 0.0 1.3e-196 639.4 0.0 1.0 1 lcl|FitnessBrowser__Putida:PP_4620 PP_4620 Fumarylacetoacetase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Putida:PP_4620 PP_4620 Fumarylacetoacetase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 639.4 0.0 1.3e-196 1.3e-196 1 419 [. 9 429 .. 9 430 .] 0.98 Alignments for each domain: == domain 1 score: 639.4 bits; conditional E-value: 1.3e-196 TIGR01266 1 sfvavak.nsdfplqnlPyGvfstkadssrrigvaiGdqildlskiaaaglfeglalkehqevfkestlnaflal 74 s+v+ a+ +sdfplqnlP+G+fs + + rr+gvaiGd ildl++++aaglf+g a+k++ e++++++lnaf+a+ lcl|FitnessBrowser__Putida:PP_4620 9 SWVEHANgHSDFPLQNLPLGIFS-RPGEARRCGVAIGDAILDLEAVLAAGLFDG-AAKAAVEATRGGALNAFFAM 81 8*****99***************.999***************************.99****************** PP TIGR01266 75 grparkevrerlqkllsesaevlrdnaalrkeallaqaeatmhlPaqiGdytdfyssirhatnvGilfrgkdnal 149 gr ar+++rerlq ll+e++e +aal+ all++++++ h+PaqiGdytdfy++i+ha+nvG+lfr +dn+l lcl|FitnessBrowser__Putida:PP_4620 82 GRNARVALRERLQVLLGEHSEH---QAALK-PALLPASDCQLHVPAQIGDYTDFYVGIEHAKNVGKLFR-PDNPL 151 *****************88877...66665.6899**********************************.***** PP TIGR01266 150 lPnykhlPvgyhGrassvvvsGtelrrPvGqikadnakePvfgpckkldlelelaffvgtenelGeavpiekaee 224 lPnyk++P+gyhGras+++ sGt++rrP+Gq+++++ eP+fgpc++ld+elel++++g++n++G+a+p+ a+e lcl|FitnessBrowser__Putida:PP_4620 152 LPNYKYVPIGYHGRASTIRPSGTDVRRPKGQTLPAGHTEPSFGPCARLDYELELGIWIGQGNDMGQAIPVGDAAE 226 *************************************************************************** PP TIGR01266 225 hifGvvllndwsardiqaweyvPlGPflaksfattvsPwvvsiealePfrvaq.lePeqdpkplpylredr..ad 296 h++G++llndwsardiqawey+PlGPfl+ksf+tt+sPwvv++ealePfr aq ++Pe+dp+pl+yl ++r a+ lcl|FitnessBrowser__Putida:PP_4620 227 HVAGLCLLNDWSARDIQAWEYQPLGPFLSKSFITTISPWVVTAEALEPFRCAQpARPEGDPQPLSYLLDKRdqAS 301 ****************************************************99**************9986577 PP TIGR01266 297 tafdielevslkteGlae....aavisrsnakslywtlkqqlahhsvnGcnlraGdllgsGtisGkeeeafGsll 367 afdielev l te ++e +++++ sn++s+ywt++q +ahhsvnGc+l++Gdl+gsGt+sG+ +++fGsll lcl|FitnessBrowser__Putida:PP_4620 302 GAFDIELEVLLLTERMREqgiaPHRLTLSNTRSMYWTVAQLVAHHSVNGCQLQPGDLFGSGTLSGATPGSFGSLL 376 89**************9999999**************************************************** PP TIGR01266 368 elsakGkkevkladgetrkfledGdevilrgvckkeGvr.vGfGecaGkvlpa 419 e++ +Gk +v+la+ge+rkfledGde+ilr++c ++Gv +GfGec+G+v++a lcl|FitnessBrowser__Putida:PP_4620 377 EITEGGKLPVELASGEVRKFLEDGDEIILRARCTRDGVAsIGFGECRGTVIAA 429 *************************************998**********998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (430 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.28 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory