GapMind for catabolism of small carbon sources

 

Aligments for a candidate for maiA in Pseudomonas putida KT2440

Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate PP_4619 PP_4619 Maleylacetoacetate isomerase

Query= reanno::pseudo6_N2E2:Pf6N2E2_5292
         (211 letters)



>lcl|FitnessBrowser__Putida:PP_4619 PP_4619 Maleylacetoacetate
           isomerase
          Length = 210

 Score =  324 bits (831), Expect = 6e-94
 Identities = 162/211 (76%), Positives = 177/211 (83%), Gaps = 3/211 (1%)

Query: 1   MELYTYYRSTSSYRVRIALALKGLDYQALPVNLIAAPGGEHRQPAYLAINPQGRVPALRT 60
           MELYTYYRSTSSYRVRIALALKGL YQ+LPVNL+    GE R   Y+A+NPQGRVPALRT
Sbjct: 1   MELYTYYRSTSSYRVRIALALKGLAYQSLPVNLLQ---GEQRGEGYVAVNPQGRVPALRT 57

Query: 61  DEGALLVQSPAIIEYLEERYPQVPLLSADLTVRAHERGVAALIGCDIHPLHNVSVLNKLR 120
           D G +LVQSPAIIEYLEE YPQ  LL A    RA  RGVAA+IGCDIHPLHNVSVLN+LR
Sbjct: 58  DGGEVLVQSPAIIEYLEEVYPQPALLPATAEARARVRGVAAIIGCDIHPLHNVSVLNRLR 117

Query: 121 QWGHDETQVTEWIGHWISQGLAAVEQLMGDDGYCFGAAPGLADVYLIPQLYAAERFNVSL 180
           Q G DE QV +WIGHWISQGLAAVEQL+GD G+CFG  PGLADVYLIPQLYAAERFN+ L
Sbjct: 118 QAGQDEGQVNQWIGHWISQGLAAVEQLIGDHGFCFGDTPGLADVYLIPQLYAAERFNIDL 177

Query: 181 QAYPRIRRVAALAAGHPAFQQAHPANQPDTP 211
            ++PRI RVAALAA HPAF +AHPA QPD+P
Sbjct: 178 DSFPRILRVAALAAAHPAFAKAHPAQQPDSP 208


Lambda     K      H
   0.320    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 263
Number of extensions: 13
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 211
Length of database: 210
Length adjustment: 21
Effective length of query: 190
Effective length of database: 189
Effective search space:    35910
Effective search space used:    35910
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)

Align candidate PP_4619 PP_4619 (Maleylacetoacetate isomerase)
to HMM TIGR01262 (maiA: maleylacetoacetate isomerase (EC 5.2.1.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01262.hmm
# target sequence database:        /tmp/gapView.32290.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01262  [M=211]
Accession:   TIGR01262
Description: maiA: maleylacetoacetate isomerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
    1.5e-90  288.5   0.0    1.7e-90  288.3   0.0    1.0  1  lcl|FitnessBrowser__Putida:PP_4619  PP_4619 Maleylacetoacetate isome


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Putida:PP_4619  PP_4619 Maleylacetoacetate isomerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  288.3   0.0   1.7e-90   1.7e-90       2     210 ..       3     207 ..       2     208 .. 0.98

  Alignments for each domain:
  == domain 1  score: 288.3 bits;  conditional E-value: 1.7e-90
                           TIGR01262   2 lYsyfrSsasyRvRiaLaLkgidyesvpvnLlkdGeqkkeefkalNPqelvPtLkidegevltqSlAiieyLeet 76 
                                         lY+y+rS++syRvRiaLaLkg++y+s pvnLl+ Geq+ e + a+NPq++vP+L++d+gevl qS AiieyLee 
  lcl|FitnessBrowser__Putida:PP_4619   3 LYTYYRSTSSYRVRIALALKGLAYQSLPVNLLQ-GEQRGEGYVAVNPQGRVPALRTDGGEVLVQSPAIIEYLEEV 76 
                                         9********************************.9**************************************** PP

                           TIGR01262  77 ypepaLlpkdpakrarvralalliacdihPlqNlrvlqlleeklgvdeeekkewlkhwiekGlaalEellkekag 151
                                         yp+paLlp+ +++rarvr +a++i+cdihPl+N++vl++l++  g+de + ++w+ hwi++Glaa+E+l+ + +g
  lcl|FitnessBrowser__Putida:PP_4619  77 YPQPALLPATAEARARVRGVAAIIGCDIHPLHNVSVLNRLRQA-GQDEGQVNQWIGHWISQGLAAVEQLIGD-HG 149
                                         *****************************************55.99************************98.45 PP

                           TIGR01262 152 afcvGdevtladvcLvpqvynAerfevdlaqyPtlkrieealaelpafqeahpenqpdt 210
                                          fc+Gd+++ladv+L+pq+y+Aerf++dl+++P++ r+++ +a++paf++ahp++qpd+
  lcl|FitnessBrowser__Putida:PP_4619 150 -FCFGDTPGLADVYLIPQLYAAERFNIDLDSFPRILRVAALAAAHPAFAKAHPAQQPDS 207
                                         .*********************************************************8 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (211 nodes)
Target sequences:                          1  (210 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 5.71
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory