Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate PP_3726 PP_3726 Enoyl-CoA hydratase/isomerase family protein
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__Putida:PP_3726 Length = 264 Score = 144 bits (364), Expect = 1e-39 Identities = 83/255 (32%), Positives = 137/255 (53%), Gaps = 3/255 (1%) Query: 8 TKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFCAGADI 67 +K E + WITLNRP++ NAL+ L++L + DP +RV+++TG G++FCAGAD+ Sbjct: 10 SKVEAGVAWITLNRPEQRNALDIPTLKQLHALLDSHADDPAVRVVVLTGSGRSFCAGADL 69 Query: 68 TQFNQLTPA---EAWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAA 124 ++ A E++ +++ +M ++ +L KPTIA ING A+GGG++L+L CD+RIAA Sbjct: 70 AEWAAAEAAGTLESYGWTETAHALMLRLHSLDKPTIAAINGTAVGGGMDLSLCCDLRIAA 129 Query: 125 EEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPL 184 A+ ++G P G + L R+IG +A ++ + A GLV+ V Sbjct: 130 ASARFKAGYTSMGYSPDAGASWHLPRLIGSEQAKRLLFLDELWGADRALAAGLVSEVCAD 189 Query: 185 ANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTEDKKEG 244 L +LA ++A + A K ++ G L L E + ++D E Sbjct: 190 EQLPAVAAELAGRLANGPTFAYAQTKRLIRDGARRTLAEQLEAERHAGLLCGRSQDGAEA 249 Query: 245 VSAFLEKREPTFKGK 259 + A +E+R P F G+ Sbjct: 250 LQASVERRTPRFTGQ 264 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 264 Length adjustment: 25 Effective length of query: 234 Effective length of database: 239 Effective search space: 55926 Effective search space used: 55926 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory