Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate PP_1143 PP_1143 3-hydroxyisobutyrate dehydrogenase family protein
Query= SwissProt::P28811 (298 letters) >FitnessBrowser__Putida:PP_1143 Length = 295 Score = 159 bits (401), Expect = 1e-43 Identities = 105/298 (35%), Positives = 157/298 (52%), Gaps = 9/298 (3%) Query: 1 MTDIAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEV 60 + + F G+G MG PM LL AG+ + V++ P LV GA+ A S + C +++ Sbjct: 5 LPSLGFAGIGLMGLPMCRRLLAAGYPLTVWNRSPDKCAALVAAGARLASSPAELCRDSDM 64 Query: 61 VISMLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPETARKVA-EAAAAKGLTLLDA 119 V+ L V + G+ G+ LLID S++ P R++A E AA G+ LDA Sbjct: 65 VLLCLADTAVVREVVFGEQGIAQGGRSGQLLIDFSSLEPTATREMAAELAALCGMAWLDA 124 Query: 120 PVSGGVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLG 179 PVSGG GA AGTL+ +VGG A RARPVL+ +G+ + H G GAGQV K CN M++ Sbjct: 125 PVSGGTPGAEAGTLAIMVGGEAADLQRARPVLQVLGQRVTHMGAVGAGQVTKACNQMIVA 184 Query: 180 ILMAGTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAGGF 239 AE +AL ++G+D +++E + G +A + P + PQ S + Sbjct: 185 CNALVIAEVVALAEQSGVDATLIAEAL----AGGFADS--KPLQILAPQMAESRFEPIKW 238 Query: 240 QVRLMNKDLGLALANAQAVQASTPLGALARNLFSLHAQADAEHEGLDFSSIQKLYRGK 297 VR + KDL A+ ++ ++TPL LA L LH + D +++ +LYR K Sbjct: 239 HVRTLLKDLDGAVKFSREQGSATPLSGLAAQLMRLHGSQGYLQK--DPATLVELYRNK 294 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 295 Length adjustment: 26 Effective length of query: 272 Effective length of database: 269 Effective search space: 73168 Effective search space used: 73168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory