Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate PP_2263 PP_2263 Sugar ABC transporter, permease protein
Query= reanno::Dino:3607127 (272 letters) >FitnessBrowser__Putida:PP_2263 Length = 266 Score = 165 bits (417), Expect = 1e-45 Identities = 84/258 (32%), Positives = 133/258 (51%) Query: 14 LVLIITVCVFPFYWMVTTSLKTQIVALEAPPVWIFEPTLSNYREALFEDGVLRTLINSLI 73 L+L + P YW++ S K+ L +W TL NYR + INSL Sbjct: 9 LLLYFFFLLVPIYWLLNMSFKSNAEILGGLTLWPQAFTLDNYRVIFTDASWYSGYINSLY 68 Query: 74 IAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPFFLIARNLGLL 133 T ++L++ +PAA+A +R+ F G + L+FW +TNRM P V LPFF + ++GL Sbjct: 69 YVCLNTLISLLVALPAAYAFSRYRFLGDRHLFFWLLTNRMAPPAVFLLPFFQLYSSIGLF 128 Query: 134 DKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKICLPLAMPGV 193 D HI + L + FN+P+ +WI+ G+P ++DE A ++G S KI +PL G+ Sbjct: 129 DTHIAVALAHCLFNVPLAVWILEGFMSGVPREIDETAYIDGYSFPRFFVKIFIPLIGSGI 188 Query: 194 AVSAIFSFIFSWNELMFGLILTRSEAKTAPAMAVSFMEGYNLPYGKIMATSTLIVIPVLI 253 V+A F F+FSW EL+ LT AK A+ + + +G + A L ++P ++ Sbjct: 189 GVTAFFCFMFSWVELLLARTLTSVNAKPIAAVMTRTVSASGIDWGVLAAAGVLTILPGML 248 Query: 254 FALIASKQLVRGLTMGAV 271 + +G +G V Sbjct: 249 VIWFVRNHVAKGFALGRV 266 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 266 Length adjustment: 25 Effective length of query: 247 Effective length of database: 241 Effective search space: 59527 Effective search space used: 59527 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory