Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate PP_0762 PP_0762 Glycerate dehydrogenase
Query= curated2:B1L765 (332 letters) >FitnessBrowser__Putida:PP_0762 Length = 321 Score = 165 bits (417), Expect = 2e-45 Identities = 105/309 (33%), Positives = 175/309 (56%), Gaps = 14/309 (4%) Query: 10 EIPERGLSKIEEHFELDLWKDEAPPSKKVIIERVKDCDALVSLLTDPIDAEVFEAAPKLR 69 ++ + LS +++ F D ++ A + + ER++ A+VS +DA A P+L+ Sbjct: 16 DLGDLDLSPLKQQF--DQFELFAATRPEQVAERLQGAVAVVSNKV-MLDAATLAANPQLK 72 Query: 70 IVAQYAVGYDNIDVKEATKRGIYVTNTPGVLTETTADFAFALLMAAARRVVEADRYVREG 129 ++ A G +N+D+ A +GI V N G T + A ALL+A A R+ + ++ V +G Sbjct: 73 LILVAATGTNNVDLAAARAQGITVCNCQGYGTPSVAQHTLALLLALATRLCDYNQAVADG 132 Query: 130 KWKVAWHPMMMLGYDVY---GRTLGIVGMGRIGAAVARRAKGFGMRILYYDSIRREDFEK 186 +W A +L + + G+TLG++G G +G AVAR A+ FGMR+L R + Sbjct: 133 QWAKA-SQFCLLDFPIVELEGKTLGLLGHGELGGAVARLAEAFGMRVLSGQIPGRPERAD 191 Query: 187 ELGVEYVPLEKLLEESDFVSLHVPLTEETYHMIGEEQLRRMKRTAILVNTSRGKVVDQKA 246 L PL++LL + D ++LH PL E T HM+G +L +K A++VNT+RG ++D++A Sbjct: 192 RL-----PLDELLPQVDALTLHCPLNEHTRHMLGARELALLKPNALVVNTARGGLIDEQA 246 Query: 247 LYKALKEGWIAGAGLDVFEQEPIPPDDPLLK--LENVVLAPHAASASHETRSRMAEMVAE 304 L AL+ G + GA DV EP +PLL+ + +++ PH+A + E+R R+ ++E Sbjct: 247 LADALRGGHLGGAATDVLSVEPPVNGNPLLEPGIPRLIITPHSAWGAVESRQRIVGQLSE 306 Query: 305 NLIAFKRGE 313 N AF G+ Sbjct: 307 NAQAFFAGQ 315 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 188 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 321 Length adjustment: 28 Effective length of query: 304 Effective length of database: 293 Effective search space: 89072 Effective search space used: 89072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory