GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xylK_Tm in Pseudomonas putida KT2440

Align Ribose import ATP-binding protein RbsA 1; EC 7.5.2.7 (characterized, see rationale)
to candidate PP_2455 PP_2455 ribose ABC transporter - ATP-binding subunit

Query= uniprot:Q9WXX0
         (520 letters)



>lcl|FitnessBrowser__Putida:PP_2455 PP_2455 ribose ABC transporter -
           ATP-binding subunit
          Length = 524

 Score =  327 bits (838), Expect = 7e-94
 Identities = 187/486 (38%), Positives = 291/486 (59%), Gaps = 25/486 (5%)

Query: 14  ILKAKGIVKRFPGVVAVDNVDFEVYENEIVSLIGENGAGKSTLIKILTGVLKPDAGEILV 73
           +L A G+ K +   V +  V   +   E+++L GENGAGKSTL K+++G+  P  G +  
Sbjct: 16  VLAASGLGKTYAQPV-LGEVSLSLRAGEVLALTGENGAGKSTLSKLISGLEVPTTGHMTY 74

Query: 74  NGERVEFHSPVDAFKKGISVIHQELNLCDNMTVAENIFLAYEAVRGQKRTLSSRVDENYM 133
            G+     S  +A + G+ ++ QELNL   +TVAEN+FL               +   + 
Sbjct: 75  RGQAYAPGSRGEAERLGVRMVMQELNLLPTLTVAENLFL-------------DNLPSRFG 121

Query: 134 YTRSKELLDLIGAKFS--------PDALVRNLTTAQRQMVEICKALVKEPRIIFMDEPTS 185
           +   K L  L  A  +        PD  V  L    +QMVEI + L+ +  ++ +DEPT+
Sbjct: 122 WISHKRLRQLATAAMARVGLDAIDPDTPVGELGIGHQQMVEIARNLIGDCHVLILDEPTA 181

Query: 186 SLTVEETERLFEIIEMLKSRGISVVFVSHRLDEVMRISDRIVVMRDGKRIGELKKGEFDV 245
            LT  E   LF  IE L++RG+++V++SHRL+E+ R++ RIVV+RDGK + +     +  
Sbjct: 182 MLTAREVALLFTQIERLRARGVAIVYISHRLEELQRVAQRIVVLRDGKLVCDEPIQRYSS 241

Query: 246 DTIIKMMVGREVEFFPHGIETRPGEIALEVRNLKWKDKVKNVSFEVRKGEVLGFAGLVGA 305
             ++ +MVGRE+         + G   L+V  L   DKV+ VSFEVR GE+ G +GL+GA
Sbjct: 242 AELVNLMVGRELGEHIDLGRRQLGAPLLKVDKLCRGDKVREVSFEVRAGEIFGISGLIGA 301

Query: 306 GRTETMLLVFGVNQKESGDIYVNG--RKVEIKNPEDAIKMGIGLIPEDRKLQGLVLRMTV 363
           GRTE + L++G ++ +SG I +    + V I +P+ A++ GI LI EDRK +GL+L  ++
Sbjct: 302 GRTELLRLIYGADRADSGGIALGQPPQAVSIDSPKAAVRAGIALITEDRKGEGLLLTQSI 361

Query: 364 KDNIVLPSLKKISRWGLVLDERKEEEISEDYVKRLSIKTPSIYQITENLSGGNQQKVVLA 423
             NI L +L  +SR G VLD   E+ ++E  ++ + I++    Q+   LSGGNQQKVV+ 
Sbjct: 362 SANIALGNLGAVSRAG-VLDSEAEKALAERQIQAMRIRSAGAQQVVGELSGGNQQKVVIG 420

Query: 424 KWLATNADILIFDEPTRGIDVGAKAEIHRMIRELAAQGKAVIMISSELPEILNLSDRIVV 483
           +WL  +  +L+FDEPTRGIDVGAK +I+ ++ ELA QGKA++++SS+L E++ + DRI V
Sbjct: 421 RWLERDCQVLLFDEPTRGIDVGAKFDIYGLLAELARQGKALVVVSSDLRELMLICDRIAV 480

Query: 484 MWEGEI 489
           +  G +
Sbjct: 481 LSAGRL 486



 Score = 72.4 bits (176), Expect = 4e-17
 Identities = 59/225 (26%), Positives = 107/225 (47%), Gaps = 8/225 (3%)

Query: 30  VDNVDFEVYENEIVSLIGENGAGKSTLIKILTGVLKPDAGEILVNG--ERVEFHSPVDAF 87
           V  V FEV   EI  + G  GAG++ L++++ G  + D+G I +    + V   SP  A 
Sbjct: 280 VREVSFEVRAGEIFGISGLIGAGRTELLRLIYGADRADSGGIALGQPPQAVSIDSPKAAV 339

Query: 88  KKGISVIHQELN---LCDNMTVAENIFLAYEAVRGQKRTLSSRVDENYMYTRSKELLDLI 144
           + GI++I ++     L    +++ NI L       +   L S   E  +  R  + + + 
Sbjct: 340 RAGIALITEDRKGEGLLLTQSISANIALGNLGAVSRAGVLDSEA-EKALAERQIQAMRIR 398

Query: 145 GAKFSPDALVRNLTTAQRQMVEICKALVKEPRIIFMDEPTSSLTVEETERLFEIIEMLKS 204
            A      +V  L+   +Q V I + L ++ +++  DEPT  + V     ++ ++  L  
Sbjct: 399 SA--GAQQVVGELSGGNQQKVVIGRWLERDCQVLLFDEPTRGIDVGAKFDIYGLLAELAR 456

Query: 205 RGISVVFVSHRLDEVMRISDRIVVMRDGKRIGELKKGEFDVDTII 249
           +G ++V VS  L E+M I DRI V+  G+ I    +  +  D ++
Sbjct: 457 QGKALVVVSSDLRELMLICDRIAVLSAGRLIDTFARDHWSQDQLL 501


Lambda     K      H
   0.319    0.138    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 639
Number of extensions: 25
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 520
Length of database: 524
Length adjustment: 35
Effective length of query: 485
Effective length of database: 489
Effective search space:   237165
Effective search space used:   237165
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory