Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate PP_3174 PP_3174 putative Oxidoreductase
Query= BRENDA::F2YCN5 (340 letters) >FitnessBrowser__Putida:PP_3174 Length = 336 Score = 124 bits (312), Expect = 3e-33 Identities = 92/299 (30%), Positives = 146/299 (48%), Gaps = 15/299 (5%) Query: 33 IGGWMWGG-TDDDASIKTIHRAIDLGINIIDTAPAYGRGHAEEVVGKAIKGQRDNLIIAT 91 +G M+G T + +++ I +A D GIN IDTA Y G +EE+VG+A+ R + I+A+ Sbjct: 18 LGSMMFGEQTSTEDALRIIDKAWDQGINFIDTADVYNAGRSEEIVGEAVARHRHDWIVAS 77 Query: 92 KVGLDWTLTPDQSMRRNSSASR--IKKEIEDSLRRLGTDYIDLYQVHWPDPLVPIEETAT 149 KVG P + S SR I ++ +L R+G DY+D+Y +H D VP+EET Sbjct: 78 KVGFG----PADGLPNRSGLSRKHIFNAVDATLTRMGMDYLDIYYLHREDHKVPLEETVQ 133 Query: 150 ILEALRKEGKIRSIGVSNYSVQQMDEFKKYAEL------AVSQSPYNLFEREIDKDILPY 203 + L ++GKIR GVSN+ ++ E AE VSQ YN+ R+ + + L Sbjct: 134 AIGDLLRQGKIRYWGVSNFRGWRIAEVCHVAERLGVPRPIVSQPLYNIVNRQAEPEQLTA 193 Query: 204 AKKNDLVVLGYGALCRGLLSGRMTADRA-FTGDDLRKTDPKFQKPRFEHYLAAVEELKKL 262 A + L V+ + L RG+LSG+ G + D + + + + + Sbjct: 194 AAAHGLGVVPFSPLARGVLSGKYAPGAVPEAGSRAGRQDKRIMEVEWRQESLTIARQIQT 253 Query: 263 AKEHYNKSVLALAIRWML-EQGPTLALWGACKPEQIDGIDEVFGWQISDEDLKQIDAIL 320 E ++ AI W+L Q + A+ G EQ D +I+ ED ID+++ Sbjct: 254 YAEAKGVGIVEFAIAWVLNNQWVSSAIVGPRTEEQWDTYGGALAAKITAEDEAFIDSLV 312 Lambda K H 0.317 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 336 Length adjustment: 28 Effective length of query: 312 Effective length of database: 308 Effective search space: 96096 Effective search space used: 96096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory