GapMind for catabolism of small carbon sources

 

Protein 6938090 in Shewanella amazonensis SB2B

Annotation: FitnessBrowser__SB2B:6938090

Length: 466 amino acids

Source: SB2B in FitnessBrowser

Candidate for 9 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
2-oxoglutarate (alpha-ketoglutarate) catabolism dctM hi alpha-ketoglutarate TRAP transporter, large permease component (characterized) 100% 100% 893.6 2,3-diketo-L-gulonate TRAP transporter large permease protein YiaN 30% 235.7
L-malate catabolism dctM hi dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), large permease component (characterized) 89% 100% 805.8 2,3-diketo-L-gulonate TRAP transporter large permease protein YiaN 30% 235.7
fumarate catabolism dctM hi dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), large permease component (characterized) 89% 100% 805.8 2,3-diketo-L-gulonate TRAP transporter large permease protein YiaN 30% 235.7
succinate catabolism dctM hi dicarboxylate TRAP transporter (succinate, fumarate, L-malate, and alpha-ketoglutarate), large permease component (characterized) 89% 100% 805.8 2,3-diketo-L-gulonate TRAP transporter large permease protein YiaN 30% 235.7
D-glucuronate catabolism dctM lo Putative TRAP dicarboxylate transporter, DctM subunit (characterized, see rationale) 31% 99% 208.4 alpha-ketoglutarate TRAP transporter, large permease component 100% 893.6
D-gluconate catabolism gntB lo TRAP-type large permease component (characterized, see rationale) 33% 93% 200.3 alpha-ketoglutarate TRAP transporter, large permease component 100% 893.6
pyruvate catabolism dctM lo Alr3027 protein, component of The 2-oxo monocarboxylate transporter (Pernil et al., 2010). Transports pyruvate which is inhibited by various 2-ketoacids (characterized) 37% 64% 151.8 alpha-ketoglutarate TRAP transporter, large permease component 100% 893.6
L-glutamate catabolism gtrB lo GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter (characterized) 36% 60% 148.7 alpha-ketoglutarate TRAP transporter, large permease component 100% 893.6
4-hydroxybenzoate catabolism fcbT3 lo FcbT3, component of Tripartite 4-chlorobenzoate symporter (also binds and may transport 4-bromo-, 4-iodo-, and 4-fluorobenzoate and with a lower affinity, 3-chlorobenzoate, 2-chlorobenzoate, 4-hydroxybenzoate, 3-hydroxybenzoate, and benzoate) (characterized) 32% 58% 115.9 alpha-ketoglutarate TRAP transporter, large permease component 100% 893.6

Sequence Analysis Tools

View 6938090 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTIATLFLTLFLCMLLGMPIAIALGFSSMLTILLFSNDSLASVALKLYEATSEHYTLLAI
PFFILSSAFLSTGGVARRIIDFAMDSVGHIRGGLAMASVMACMLFAAVSGSSPATVAAIG
SIVIVGMVRAGYPQKFAAGVITTSGTLGILIPPSIVMLVYAAATEVSAARMFMAGLIPGL
LMGVLLMVAIYIVARIKNLPSRPFPGVKALSLSSAKAMGGLALIFIVLGSIYGGVASPTE
AAAVACVYAYLVAVFGYRDIGPLKEVPWRKEGEAILAAIVRNLLHVGLGLIKTPTDKEIR
NVVRDGAKVSIMLLFIIANAMLFAHVLTTERIPHIIAETIVGWGLPPWGFLIIVNLLLLA
AGNFMEPSAILLIMAPILFPIAVQLGIDPIHLGIIMVVNMEIGMLTPPVGLNLFVTAGIT
GRSIGWVIHACLPWLLLLLGFLVLITYVPQISLFLPEYLDSLRGFK

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory