Protein 6939439 in Shewanella amazonensis SB2B
Annotation: FitnessBrowser__SB2B:6939439
Length: 370 amino acids
Source: SB2B in FitnessBrowser
Candidate for 39 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
putrescine catabolism | potA | lo | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) | 40% | 61% | 177.6 | ABC-type molybdate transporter (EC 7.3.2.5) | 30% | 174.1 |
D-maltose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 40% | 63% | 168.7 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
trehalose catabolism | thuK | lo | Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 40% | 63% | 168.7 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
L-arabinose catabolism | xacK | lo | Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) | 41% | 59% | 162.2 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-cellobiose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 40% | 63% | 157.9 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-glucose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 40% | 63% | 157.9 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
lactose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 40% | 63% | 157.9 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-maltose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 40% | 63% | 157.9 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
sucrose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 40% | 63% | 157.9 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
trehalose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 40% | 63% | 157.9 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-glucosamine (chitosamine) catabolism | SM_b21216 | lo | ABC transporter for D-Glucosamine, ATPase component (characterized) | 40% | 65% | 157.5 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
L-fucose catabolism | SM_b21106 | lo | ABC transporter for L-Fucose, ATPase component (characterized) | 41% | 58% | 156.8 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
xylitol catabolism | HSERO_RS17020 | lo | ABC-type sugar transport system, ATPase component protein (characterized, see rationale) | 32% | 82% | 154.5 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
N-acetyl-D-glucosamine catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 40% | 65% | 152.5 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-glucosamine (chitosamine) catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 40% | 65% | 152.5 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
L-proline catabolism | opuBA | lo | BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) | 37% | 57% | 151.8 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-cellobiose catabolism | msiK | lo | MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) | 32% | 79% | 151.4 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-maltose catabolism | malK1 | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 35% | 67% | 150.2 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
lactose catabolism | lacK | lo | ABC transporter for Lactose, ATPase component (characterized) | 40% | 60% | 149.8 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-maltose catabolism | malK_Bb | lo | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 41% | 62% | 149.4 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
L-arabinose catabolism | xacJ | lo | Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) | 39% | 54% | 149.1 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
L-arabinose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 30% | 89% | 146.4 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-fructose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 30% | 89% | 146.4 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-maltose catabolism | musK | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 36% | 67% | 146.4 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
sucrose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 30% | 89% | 146.4 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-xylose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 30% | 89% | 146.4 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-maltose catabolism | malK_Aa | lo | ABC-type maltose transporter (EC 7.5.2.1) (characterized) | 40% | 57% | 144.8 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
xylitol catabolism | Dshi_0546 | lo | ABC transporter for Xylitol, ATPase component (characterized) | 36% | 66% | 144.1 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-mannitol catabolism | mtlK | lo | SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) | 38% | 70% | 143.3 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-cellobiose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 70% | 141 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-glucose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 70% | 141 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
lactose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 70% | 141 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-maltose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 70% | 141 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
D-maltose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 70% | 141 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
sucrose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 70% | 141 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
sucrose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 70% | 141 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
trehalose catabolism | aglK | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 70% | 141 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
trehalose catabolism | aglK' | lo | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 35% | 70% | 141 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
trehalose catabolism | treV | lo | TreV, component of Trehalose porter (characterized) | 33% | 81% | 132.9 | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 | 40% | 177.6 |
Sequence Analysis Tools
View 6939439 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MSGSTELRVQIRQTKGIRIEADFSCRAGEFLAVVGPSGGGKTTLLRMIAGLAKPENGSIR
CGKRIWFDSDEGIHCSPQNRHIGFVPQHFGLFPKLSALGNIMAALDHLPSQERRPRALAA
LEKVNLHGLTDRLPSQLSGGQKQRVALARALAREPRVLLLDEPFSAVDRETRERLYLELA
RLKAELNIPVIMVTHDLNEALLLADSMLLISQGHMLQHGTPQDVFSRPRNEAVARQMGLR
NIFNAHVVAQDCAKGVTWLKFGDRLIASDSLPRVNIGDKVRWVIPNQGIRFNSIASGRLC
RSFNILPIHIDNMLTLGESVRLEASVQDSGERLNVEIPLHLAHKLALTQGAATEVALKSD
QVHILEMIKA
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory